Id: acc3641
Group: 1sens
Protein: DOR
Gene Symbol: Oprd1
Protein Id: P33533
Protein Name: OPRD_RAT
PTM: phosphorylation
Site: Thr161
Site Sequence: HPVKALDFRTPAKAKLINICI
Disease Category: Immune system diseases
Disease: Inflammatory
Disease Subtype: Inflammatory Pain (CFA Model)
Disease Cellline:
Disease Info:
Drug: Morphine
Drug Info: Morphine is a potent opioid analgesic commonly used for the relief of severe pain.
Relation:
Morphine
DOR-Thr161 UP
Inflammatory Aggravate
Effect: tolerate
Effect Info: "In the rat model of CFA-induced inflammatory pain, Cdk5-mediated phosphorylation of the Thr-161 site of the DOR receptor can enhance morphine tolerance and inhibit hyperalgesia. Blocking the phosphorylation of this site can significantly relieve morphine tolerance, suggesting that phosphorylation of DOR Thr-161 is a key mechanistic target for regulating the effects of opioids."
Note:
Score: 5.0
Pubmed(PMID): 22466129
Sentence Index:
Sentence:

Sequence & Structure:

MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTACTPSDGPGGGAAA

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: