Id: | acc3623 |
Group: | 1sens |
Protein: | p38 MAPK |
Gene Symbol: | MAPK14 |
Protein Id: | Q16539 |
Protein Name: | MK14_HUMAN |
PTM: | phosphorylation |
Site: | Tyr182 |
Site Sequence: | RHTDDEMTGYVATRWYRAPEI |
Disease Category: | Immune system diseases |
Disease: | Allergic |
Disease Subtype: | |
Disease Cellline: | HMC-1 |
Disease Info: | |
Drug: | Angelica acutiloba |
Drug Info: | Angelica acutiloba is a well - known traditional medicinal herb often used in Asian traditional medicine. It has various potential health benefits. |
Relation: |
Angelica acutiloba
➜
p38 MAPK-Tyr182
DOWN
➜
Allergic
Alleviate
|
Effect: | modulate |
Effect Info: | "Angelica sinensis inhibits mast cell-derived allergic reactions by suppressing histamine release, the production of pro-inflammatory cytokines, and the phosphorylation of ERK, JNK, and p38 MAPK." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 22129085 |
Sentence Index: | 22129085_9 |
Sentence: | "In conclusion, AAE inhibited mast cell-derived allergic reactions by inhibiting the release of histamine, the production of pro-inflammatory cytokines, and the phosphorylation of ERK and JNK." |
Sequence & Structure:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
MAPK14 | ARRY-797 | MAP kinase p38 alpha inhibitor | 3 | Terminated | dilated cardiomyopathy | ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 3 | Completed | acute coronary syndrome | ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 3 | Terminated | COVID-19 | ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 3 | Active, not recruiting | Facioscapulohumeral dystrophy | ClinicalTrials |
MAPK14 | ACUMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials ClinicalTrials |
MAPK14 | SEMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | Crohn's disease | ClinicalTrials ClinicalTrials ClinicalTrials |
MAPK14 | PF-03715455 | MAP kinase p38 alpha inhibitor | 2 | Terminated | chronic obstructive pulmonary disease | ClinicalTrials |
MAPK14 | DILMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials |
MAPK14 | AZD-7624 | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials |
MAPK14 | SEMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Terminated | Crohn's disease | ClinicalTrials |
MAPK14 | PH-797804 | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials ClinicalTrials ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
MAPK14 | ARRY-797 | MAP kinase p38 alpha inhibitor | 2 | Completed | dilated cardiomyopathy | ClinicalTrials ClinicalTrials |
MAPK14 | DORAMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Terminated | rheumatoid arthritis | ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | BMS-582949 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials |
MAPK14 | DORAMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | psoriasis | ClinicalTrials |
MAPK14 | BMS-582949 | MAP kinase p38 alpha inhibitor | 2 | Completed | psoriasis | ClinicalTrials |
MAPK14 | DILMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | PG-760564 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials |
MAPK14 | TAK-715 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials |
MAPK14 | TALMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | PH-797804 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | VX-702 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | DILMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | coronary artery disease | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACMAPK14-Tyr182 | |
---|---|
Cancer | Intensity |
BRCA | 2.374 |
COAD | -0.005 |
HGSC | -0.861 |
ccRCC | 0.066 |
GBM | 1.175 |
HNSC | -0.22 |
LUAD | 0.029 |
LUSC | -0.105 |
non_ccRCC | -0.927 |
PDAC | -0.488 |
UCEC | -1.039 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
Y | 182 | D | Breast cancer/tumor/carcinoma | Phosphorylation | 23771849 |
Y | 182 | U | Bladder cancer | Phosphorylation | 33204153 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.