Id: | acc3611 |
Group: | 1sens |
Protein: | p38 |
Gene Symbol: | Mapk14 |
Protein Id: | P47811 |
Protein Name: | MK14_MOUSE |
PTM: | phosphorylation |
Site: | Tyr182 |
Site Sequence: | RHTDDEMTGYVATRWYRAPEI |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Barrier Dysfunction |
Disease Subtype: | vascular endothelial dysfunction |
Disease Cellline: | HPAEC |
Disease Info: | |
Drug: | 2-methoxyestradiol(2-ME) |
Drug Info: | 2-methoxyestradiol (2-ME) is a synthetic derivative of estradiol with potential anti-angiogenic and anti-tumor properties. |
Relation: |
p38-Tyr182
DOWN
+
2-methoxyestradiol(2-ME)
➜
Barrier Dysfunction
Alleviate
|
Effect: | suppress |
Effect Info: | Tubacin pretreatment or Taxol can inhibit 2ME-induced phosphorylation of p38 and MLC and alleviate 2ME-induced vascular leakage. |
Note: | |
Score: | 5.0 |
Pubmed(PMID): | 22074808 |
Sentence Index: | 22074808_8 |
Sentence: | "Inhibition of histone deacetylase 6 (HDAC6) with tubacin increases tubulin acetylation level, suppresses 2ME-induced HSP27 and MLC phosphorylation, and decreases 2ME-induced barrier dysfunction, suggesting barrier-protective and/or barrier-restorative role for tubulin acetylation in vascular endothelium." |
Sequence & Structure:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.