Id: acc3590
Group: 1sens
Protein: p38 MAP kinase
Gene Symbol: Mapk14
Protein Id: P70618
Protein Name: MK14_RAT
PTM: phosphorylation
Site: Thr180
Site Sequence: LARHTDDEMTGYVATRWYRAP
Disease Category: Nervous system diseases
Disease: Mania-Like Behavior
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: Ouabain
Drug Info: Ouabain is a cardiac glycoside that can be used to increase the force of heart contractions and is commonly used in the study of cardiac function.
Relation:
Ouabain
p38 MAP kinase-Thr180 UP
Mania-Like Behavior Aggravate
Effect: modulate
Effect Info: "Ouabain → Inhibition of Na/K-ATPase → Activation of ERK1/2 (↑ phosphorylation) → ↑ Phosphorylation of p90RSK → ↑ Phosphorylation of TH → ↑ Dopamine synthesis → ↑ Mania-like behavior. Ouabain treatment also leads to a decrease in the phosphorylation of CaMKIIalpha and p38, which are related to neuromodulation. "
Note:
Score: 4.0
Pubmed(PMID): 21871514
Sentence Index:
Sentence:

Sequence & Structure:

MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: