Id: | acc3590 |
Group: | 1sens |
Protein: | p38 MAP kinase |
Gene Symbol: | Mapk14 |
Protein Id: | P70618 |
Protein Name: | MK14_RAT |
PTM: | phosphorylation |
Site: | Thr180 |
Site Sequence: | LARHTDDEMTGYVATRWYRAP |
Disease Category: | Nervous system diseases |
Disease: | Mania-Like Behavior |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Ouabain |
Drug Info: | Ouabain is a cardiac glycoside that can be used to increase the force of heart contractions and is commonly used in the study of cardiac function. |
Relation: |
Ouabain
➜
p38 MAP kinase-Thr180
UP
➜
Mania-Like Behavior
Aggravate
|
Effect: | modulate |
Effect Info: | "Ouabain → Inhibition of Na/K-ATPase → Activation of ERK1/2 (↑ phosphorylation) → ↑ Phosphorylation of p90RSK → ↑ Phosphorylation of TH → ↑ Dopamine synthesis → ↑ Mania-like behavior. Ouabain treatment also leads to a decrease in the phosphorylation of CaMKIIalpha and p38, which are related to neuromodulation. " |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 21871514 |
Sentence Index: | 21871514_3 |
Sentence: | "Previously, we have reported that intracerebroventricular (ICV) injection of ouabain, a selective Na/K-ATPase inhibitor, induces hyperactivity in rats that mimics manic symptoms related to the activation of extracellular signal-regulated protein kinase1/2 (ERK1/2), which plays crucial roles in the modulation of TH phosphorylation." |
Sequence & Structure:
MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.