Id: acc3581
Group: 1sens
Protein: ERK2
Gene Symbol: Mapk1
Protein Id: P63085
Protein Name: MK01_MOUSE
PTM: phosphorylation
Site: unclear
Site Sequence:
Disease Category: Musculoskeletal system diseases
Disease: Muscular Dystrophy
Disease Subtype: mdx mouse model
Disease Cellline:
Disease Info:
Drug: AT-1 receptor blockers (ARB)
Drug Info: "AT - 1 receptor blockers (ARB) are drugs that block the action of angiotensin II at the AT - 1 receptor, which helps lower blood pressure."
Relation:
AT-1 receptor blockers (ARB)
ERK2-unclear DOWN
Muscular Dystrophy Alleviate
Effect: modulate
Effect Info: "ARB significantly reduced the levels of extracellular matrix proteins, alpha–SMA, and ERK–1/2 phosphorylation induced by CTGF overexpression and effectively prevented the loss of skeletal muscle contractility, demonstrating the potential of ARB as a novel drug tool for treating fibrosis associated with muscular dystrophy."
Note:
Score: 4.0
Pubmed(PMID): 21645240
Sentence Index:
Sentence:

Sequence & Structure:

MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
- - D EL4 thymoma Phosphorylation 10753946

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: