Id: | acc3556 |
Group: | 1sens |
Protein: | ERK2 |
Gene Symbol: | MAPK1 |
Protein Id: | P28482 |
Protein Name: | MK01_HUMAN |
PTM: | phosphorylation |
Site: | Tyr187 |
Site Sequence: | HDHTGFLTEYVATRWYRAPEI |
Disease Category: | Endocrine and metabolic diseases |
Disease: | Diabetes Mellitus |
Disease Subtype: | insulin resistance |
Disease Cellline: | HL-1 |
Disease Info: | |
Drug: | H2O2 |
Drug Info: | "H2O2 is hydrogen peroxide, a common disinfectant and oxidizing agent." |
Relation: |
H2O2
➜
ERK2-Tyr187
UP
➜
Diabetes Mellitus
Aggravate
|
Effect: | modulate |
Effect Info: | "Chronic treatment of HL–1 adult cardiomyocytes with hydrogen peroxide leads to insulin resistance, accompanied by excessive phosphorylation of ERK. The ERK inhibitor U0126 can enhance insulin sensitivity, while the PI3K inhibitor LY294002 exacerbates insulin resistance." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 21270272 |
Sentence Index: | 21270272_8 |
Sentence: | "In the hearts of streptozotocin-induced diabetic mice and diabetic patients Nrf2 expression significantly decreased along with significant increases in 3-nitrotyrosine accumulation and ERK phosphorylation, whereas these pathogenic changes were not observed in the heart of diabetic mice with cardiac-specific overexpression of a potent antioxidant metallothionein." |
Sequence & Structure:
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Terminated | neoplasm | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 2 | Completed | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Recruiting | histiocytic neoplasm | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Active, not recruiting | Uveal Melanoma | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 2 | Terminated | cancer | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | acute myeloid leukemia | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | myelodysplastic syndrome | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 1 | Recruiting | acute myeloid leukemia | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials |
MAPK1 | RAVOXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Terminated | neoplasm | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Recruiting | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Terminated | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Recruiting | metastatic colorectal cancer | ClinicalTrials |
MAPK1 | KO-947 | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 1 | Terminated | cancer | ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Completed | colorectal cancer | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 0.5 | Recruiting | glioblastoma multiforme | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 0.5 | Recruiting | Paraganglioma | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACMAPK1-Tyr187 | |
---|---|
Cancer | Intensity |
BRCA | 0.772 |
COAD | 0.273 |
HGSC | 0.701 |
ccRCC | -0.806 |
GBM | 0.279 |
HNSC | 0.328 |
LUAD | 0.387 |
LUSC | 0.866 |
non_ccRCC | -2.593 |
PDAC | 0.32 |
UCEC | -0.527 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
Y | 187 | U | Thyroid cancer/carcinoma | Phosphorylation | 17209045 |
Y | 187 | U | Triple-negative breast cancer | Phosphorylation | 28415597 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMProtein | Gene | PTM | Position | Modified sequence | Cell | Drug | pEC50 | Regulation | Experiment |
---|---|---|---|---|---|---|---|---|---|
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | A431 | Imatinib | 5.4775 | up | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | BT-474 | Lapatinib | 6.6172 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | K562 | Dasatinib | 8.8776 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | KYSE-520 | SHP099 | 6.2002 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | MDA-MB-175 | Lapatinib | 7.3646 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | MDA-MB-175 | Pertuzumab | -4.632 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | PC-9 | LapatinibAZD4547 | 6.4194 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | PC-9 | Lapatinib | 6.4558 | down | |
P28482 | MAPK1 | P | Thr185;Tyr187 | VADPDHDHTGFLT(ph)EY(ph)VATR | SK-BR-3 | Trastuzumab | -1.2287 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | A431 | Dasatinib | 6.1777 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | SK-BR-3 | Trastuzumab | -0.81 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | SK-BR-3 | Pertuzumab | -1.7704 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | SK-BR-3 | Lapatinib | 4.7218 | - | |
P28482 | MAPK1 | P | Tyr187;Thr190 | VADPDHDHTGFLTEY(ph)VAT(ph)R | PC-9 | AZD4547 | 1.938 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | PC-9 | AZD4547 | 7.196 | - | |
P28482 | MAPK1 | P | Thr185;Tyr187 | VADPDHDHTGFLT(ph)EY(ph)VATR | PC-9 | AZD4547 | 7.2923 | - | |
P28482 | MAPK1 | P | Thr185;Tyr187 | VADPDHDHTGFLT(ph)EY(ph)VATR | MDA-MB-175 | Trastuzumab | -1.6811 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | MDA-MB-175 | Trastuzumab | 5 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | K562 | Imatinib | 7.13 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | BT-474 | Trastuzumab | -2.1745 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | BT-474 | Pertuzumab | -1.9633 | - |
pEC50 Note: pEC50 is the negative logarithm of EC50 (half-maximal effective concentration, dosage unit Mol), calculated as pEC50 = -log10(EC50), which quantifies the potency of a drug or compound.
Function score:
source: funscoRNo data.