Id: | acc3537 |
Group: | 1sens |
Protein: | NR2B |
Gene Symbol: | Grin2b |
Protein Id: | Q62923 |
Protein Name: | PNOC_RAT |
PTM: | phosphorylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Nervous system diseases |
Disease: | Changes In Sensory Pathway Properties |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | CYP |
Drug Info: | "CYP refers to Cytochrome P450, a family of enzymes involved in the metabolism of various drugs and endogenous compounds." |
Relation: |
CYP
➜
NR2B-unclear
UP
➜
Changes In Sensory Pathway Properties
Alleviate
|
Effect: | modulate |
Effect Info: | CYP may promote the enhancement of spinal reflexes through nitric oxide and Cdk5-dependent NR2B phosphorylation. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 21106858 |
Sentence Index: | 21106858_6 |
Sentence: | These results suggested that CYP might facilitate spinal reflex potentiation mediated by N-methyl-d-aspartate receptors and participate in the development of visceral hypereflexia/hyperalgesia through nitric oxide- and Cdk5-dependent NR2B phosphorylation at the lumbosacral dorsal horn. |
Sequence & Structure:
MKILFCDVLLLSLLSSVFSSCPEDCLTCQERLHPAPGSFNLKLCILQCEEKVFPRPLWTLCTKAMASDSEQLSPADPELTSAALYQSKASEMQHLKRMPRVRSVVQARDAEPEADAEPVADEADEVEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.