Id: | acc3536 |
Group: | 1sens |
Protein: | histone H3 |
Gene Symbol: | H3C1 |
Protein Id: | P68431 |
Protein Name: | H31_HUMAN |
PTM: | acetylation |
Site: | Lys14 |
Site Sequence: | KQTARKSTGGKAPRKQLATKA |
Disease Category: | Cancer |
Disease: | Colorectal Cancer |
Disease Subtype: | |
Disease Cellline: | SW620 |
Disease Info: | |
Drug: | Vorinostat + Capecitabine |
Drug Info: | Vorinostat is a histone deacetylase (HDAC) inhibitor | Capecitabine is an oral chemotherapy drug that is converted into an active form in the body. |
Relation: |
Vorinostat + Capecitabine
➜
histone H3-Lys14
UP
➜
Colorectal Cancer
Alleviate
|
Effect: | modulate |
Effect Info: | "Vorinostat combined with capecitabine effectively inhibits tumor growth, increases cell apoptosis and prolongs survival time. The level of acetylated H3 (AcH3) in transplanted tumors is significantly increased." |
Note: | "drug comb, hisone" |
Score: | 3.0 |
Pubmed(PMID): | 21045833 |
Sentence Index: | 21045833_2 |
Sentence: | "In colorectal cancer (CRC) cells, we evaluated whether the histone deacetylase-inhibitor vorinostat may induce synergistic antitumour effects in combination with capecitabine by modulating the expression of thymidine phosphorylase (TP), a key enzyme in the conversion of capecitabine to 5-florouracil (5-FU), and thymidylate synthase (TS), the target of 5-FU." |
Sequence & Structure:
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
K | 14 | D | Cervical intraepithelial neoplasia | Acetylation | 28716899 |
K | 14 | D | Prostate cancer | Acetylation | 19885564 |
K | 14 | D | Systemic lupus erythematosus | Acetylation | 36165173 |
K | 14 | U | Marfan syndrome | Acetylation | 20829218 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.