Id: | acc3535 |
Group: | 1sens |
Protein: | histone H3 |
Gene Symbol: | H3C1 |
Protein Id: | P68431 |
Protein Name: | H31_HUMAN |
PTM: | acetylation |
Site: | Lys9 |
Site Sequence: | -MARTKQTARKSTGGKAPRKQ |
Disease Category: | Cancer |
Disease: | Colorectal Cancer |
Disease Subtype: | |
Disease Cellline: | SW620 |
Disease Info: | |
Drug: | Vorinostat + Capecitabine |
Drug Info: | Vorinostat is a histone deacetylase (HDAC) inhibitor | Capecitabine is an oral chemotherapy drug that is converted into an active form in the body. |
Relation: |
Vorinostat + Capecitabine
➜
histone H3-Lys9
UP
➜
Colorectal Cancer
Alleviate
|
Effect: | modulate |
Effect Info: | "Vorinostat combined with capecitabine effectively inhibits tumor growth, increases apoptosis, and prolongs survival time." |
Note: | "drug comb, hisone" |
Score: | 3.0 |
Pubmed(PMID): | 21045833 |
Sentence Index: | 21045833_2 |
Sentence: | "In colorectal cancer (CRC) cells, we evaluated whether the histone deacetylase-inhibitor vorinostat may induce synergistic antitumour effects in combination with capecitabine by modulating the expression of thymidine phosphorylase (TP), a key enzyme in the conversion of capecitabine to 5-florouracil (5-FU), and thymidylate synthase (TS), the target of 5-FU." |
Sequence & Structure:
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
K | 9 | D | Diabetes mellitus | Acetylation | 23423566 |
K | 9 | D | Friedreich's ataxia | Acetylation | 18045775 |
K | 9 | D | Prostate cancer | Acetylation | 19885564 |
K | 9 | D | Systemic lupus erythematosus | Acetylation | 36165173 |
K | 9 | D | Prostate cancer | Methylation | 19739128 |
K | 9 | D | Pancreatic carcinoma | Methylation | 20142597 |
K | 9 | U | Prostate cancer | Acetylation | 19935671 |
K | 9 | U | Diabetes mellitus | Acetylation | 23423566 |
K | 9 | U | Gastric adenocarcinoma | Acetylation | 18470569 |
K | 9 | U | Type 2 diabetes | Acetylation | 34944721 |
K | 9 | U | Breast cancer | Methylation | 19943104 |
K | 9 | U | Friedreich's ataxia | Methylation | 18045775 |
K | 9 | U | Friedreich's ataxia | Methylation | 18045775 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.