Id: | acc3534 |
Group: | 1sens |
Protein: | GSK3beta |
Gene Symbol: | Gsk3b |
Protein Id: | P18266 |
Protein Name: | GSK3B_RAT |
PTM: | phosphorylation |
Site: | Ser9 |
Site Sequence: | -MSGRPRTTSFAESCKPVQQP |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Myocardial Infarction |
Disease Subtype: | STZ induced diabetes mellitus |
Disease Cellline: | |
Disease Info: | |
Drug: | EPO |
Drug Info: | "EPO, or erythropoietin, is a hormone that stimulates the production of red blood cells. It is sometimes misused in sports as a performance - enhancing drug." |
Relation: |
EPO
➜
GSK3beta-Ser9
UP
➜
Myocardial Infarction
Alleviate
|
Effect: | no effect |
Effect Info: | "In the hearts of healthy rats, EPO can significantly reduce the myocardial infarction area and enhance the phosphorylation of Akt, ERK1/2, and GSK - 3beta. However, in STZ - induced diabetic rats, EPO fails to produce a protective effect." |
Note: | |
Score: | 2.0 |
Pubmed(PMID): | 20981553 |
Sentence Index: | 20981553_7 |
Sentence: | "In hearts from STZ-induced diabetic rats, EPO did not decrease infarct size (32.05 +- 2.38 and 31.88 +- 1.87% in EPO-treated and untreated diabetic rat hearts, respectively, NS) nor did it increase phosphorylation of Akt, ERK1/2, and GSK-3beta." |
Sequence & Structure:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDMWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.