Id: | acc3533 |
Group: | 1sens |
Protein: | ERK2 |
Gene Symbol: | Mapk1 |
Protein Id: | P63086 |
Protein Name: | MK01_RAT |
PTM: | phosphorylation |
Site: | Tyr187 |
Site Sequence: | HTGFLTEYVATRWYRAPEIML |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Myocardial Infarction |
Disease Subtype: | STZ induced diabetes mellitus |
Disease Cellline: | |
Disease Info: | |
Drug: | EPO |
Drug Info: | "EPO, or erythropoietin, is a hormone that stimulates the production of red blood cells. It is sometimes misused in sports as a performance - enhancing drug." |
Relation: |
EPO
➜
ERK2-Tyr187
UP
➜
Myocardial Infarction
Alleviate
|
Effect: | no effect |
Effect Info: | "In the hearts of healthy rats, EPO can significantly reduce the myocardial infarction area and enhance the phosphorylation of Akt, ERK1/2, and GSK - 3beta. However, in STZ - induced diabetic rats, EPO fails to produce a protective effect." |
Note: | |
Score: | 2.0 |
Pubmed(PMID): | 20981553 |
Sentence Index: | 20981553_7 |
Sentence: | "In hearts from STZ-induced diabetic rats, EPO did not decrease infarct size (32.05 +- 2.38 and 31.88 +- 1.87% in EPO-treated and untreated diabetic rat hearts, respectively, NS) nor did it increase phosphorylation of Akt, ERK1/2, and GSK-3beta." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | A | Basophilic leukemia | Phosphorylation | 11971018 |
T | 183 | D | Major depressive disorder | Phosphorylation | 16959794 |
Y | 185 | D | Major depressive disorder | Phosphorylation | 16959794 |
T | 183 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
Y | 185 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.