Id: | acc3520 |
Group: | 1sens |
Protein: | PPARgamma |
Gene Symbol: | Pparg |
Protein Id: | P37238 |
Protein Name: | PPARG_MOUSE |
PTM: | phosphorylation |
Site: | Ser273 |
Site Sequence: | ILTGKTTDKSPFVIYDMNSLM |
Disease Category: | Endocrine and metabolic diseases |
Disease: | Obese |
Disease Subtype: | insulin resistance |
Disease Cellline: | |
Disease Info: | |
Drug: | Rosiglitazone |
Drug Info: | Rosiglitazone is a thiazolidinedione antidiabetic drug that works by improving insulin sensitivity. |
Relation: |
PPARgamma-Ser273
DOWN
+
Rosiglitazone
➜
Obese
Alleviate
|
Effect: | modulate |
Effect Info: | Rosiglitazone inhibits PPARgamma phosphorylation in obese patients and alleviates insulin resistance. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 20651683 |
Sentence Index: | 20651683_6 |
Sentence: | "Similarly, inhibition of PPARgamma phosphorylation in obese patients by rosiglitazone is very tightly associated with the anti-diabetic effects of this drug." |
Sequence & Structure:
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 273 | U | Hepatitis | Phosphorylation | 30008738 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.