Id: acc3495
Group: 1sens
Protein: p38 MAPK
Gene Symbol: Mapk14
Protein Id: P47811
Protein Name: MK14_MOUSE
PTM: phosphorylation
Site: Thr180
Site Sequence: LARHTDDEMTGYVATRWYRAP
Disease Category: Cardiovascular and circulatory system diseases
Disease: Dilated Cardiomyopathy
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: Propylthiouracil (PTU)
Drug Info: Propylthiouracil (PTU) is an antithyroid drug used to treat hyperthyroidism by reducing the production of thyroid hormones.
Relation:
Propylthiouracil (PTU)
p38 MAPK-Thr180 DOWN
Dilated Cardiomyopathy Alleviate
Effect: modulate
Effect Info: "The phosphorylation levels of Akt and p38 mitogen-activated protein kinase (p38 MAPK) were elevated in the hearts of DCM mice, and PTU treatment significantly reduced these phosphorylation levels. This strongly indicates that the upregulation of Dio2 is involved in cardiac remodeling in DCM by activating the TH signaling pathway involving Akt and p38 MAPK."
Note:
Score: 4.0
Pubmed(PMID): 20453157
Sentence Index:
Sentence:

Sequence & Structure:

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: