Id: | acc3485 |
Group: | 1sens |
Protein: | p65 |
Gene Symbol: | Rela |
Protein Id: | P58546 |
Protein Name: | MTPN_HUMAN |
PTM: | phosphorylation |
Site: | Ser536 |
Site Sequence: | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Myocardial I/R Injury |
Disease Subtype: | diabetic |
Disease Cellline: | |
Disease Info: | |
Drug: | Tanshinone IIA |
Drug Info: | "Tanshinone IIA is a lipophilic diterpene quinone isolated from Salvia miltiorrhiza, which has various pharmacological activities such as anti - inflammatory and anti - oxidative effects." |
Relation: |
Tanshinone IIA
➜
p65-Ser536
UP
➜
Myocardial I/R Injury
Alleviate
|
Effect: | modulate |
Effect Info: | The protective effect of tanshinone on myocardial ischemia/reperfusion (I/R) injury in diabetic rats by enhancing the phosphorylation of Akt and inhibiting the phosphorylation of NF–κB via the PI3K/Akt pathway. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 20380652 |
Sentence Index: | 20380652_10 |
Sentence: | "Moreover, pretreatment with wortmannin abolished the beneficial effects of TSN: a reduction of infarct size, a decrease in LVEF, inhibition of myocardial apoptosis and Akt phosphorylation, enhancement of NF-kappaB phosphorylation and an increase of cytokine production including TNF-alpha and IL-6 after I/R injury in diabetic rats." |
Sequence & Structure:
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.