Id: acc3481
Group: 1sens
Protein: p38 MAPK
Gene Symbol: Mapk14
Protein Id: P70618
Protein Name: MK14_RAT
PTM: phosphorylation
Site: Thr180
Site Sequence: LARHTDDEMTGYVATRWYRAP
Disease Category: Endocrine and metabolic diseases
Disease: Diabetes Mellitus
Disease Subtype: STZ induced
Disease Cellline:
Disease Info:
Drug: arjunolic acid
Drug Info: Streptozotocin is a chemotherapeutic agent used in the treatment of pancreatic cancer. | Arjunolic acid has various pharmacological activities such as anti - inflammatory and antioxidant properties.
Relation:
arjunolic acid
p38 MAPK-Thr180 DOWN
Diabetes Mellitus Aggravate
Effect: modulate
Effect Info: "STZ exposure led to increased concentrations of phosphorylated ERK, phosphorylated JNK, and phosphorylated p38 immune responses in diabetic spleen tissue. This can be reduced by AA treatment, which can prevent hyperglycemia and its associated pathological changes."
Note:
Score: 4.0
Pubmed(PMID): 20053369
Sentence Index:
Sentence:

Sequence & Structure:

MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: