Id: acc3476
Group: 1sens
Protein: ERK2
Gene Symbol: Mapk1
Protein Id: P63086
Protein Name: MK01_RAT
PTM: phosphorylation
Site: Thr185
Site Sequence: HDHTGFLTEYVATRWYRAPEI
Disease Category: Endocrine and metabolic diseases
Disease: Diabetes Mellitus
Disease Subtype: STZ induced
Disease Cellline:
Disease Info:
Drug: arjunolic acid
Drug Info: Streptozotocin is a chemotherapeutic agent used in the treatment of pancreatic cancer. | Arjunolic acid has various pharmacological activities such as anti - inflammatory and antioxidant properties.
Relation:
arjunolic acid
ERK2-Thr185 DOWN
Diabetes Mellitus Aggravate
Effect: modulate
Effect Info: "STZ exposure led to increased concentrations of phosphorylated ERK, phosphorylated JNK, and phosphorylated p38 immune responses in diabetic spleen tissue. This can be reduced by AA treatment, which can prevent hyperglycemia and its associated pathological changes."
Note:
Score: 4.0
Pubmed(PMID): 20053369
Sentence Index:
Sentence:

Sequence & Structure:

MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
Y 185 D Major depressive disorder Phosphorylation 16959794
Y 185 U Uteroplacental insufficiency Phosphorylation 16940436

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: