Id: | acc3464 |
Group: | 1sens |
Protein: | ERK2 |
Gene Symbol: | Mapk1 |
Protein Id: | P63085 |
Protein Name: | MK01_MOUSE |
PTM: | phosphorylation |
Site: | Tyr187 |
Site Sequence: | HTGFLTEYVATRWYRAPEIML |
Disease Category: | Infectious diseases |
Disease: | Endotoxic Shock |
Disease Subtype: | Endotoxic Shock |
Disease Cellline: | |
Disease Info: | |
Drug: | U0126 |
Drug Info: | "U0126 is a drug, but specific details about it are not provided." |
Relation: |
U0126
➜
ERK2-Tyr187
DOWN
➜
Endotoxic Shock
Aggravate
|
Effect: | modulate |
Effect Info: | Glutamine (Gln) effectively protects mice from lethal endotoxic shock by rapidly inducing mitogen-activated protein kinase phosphatase-1 (MKP-1). Studies have shown that Gln can inhibit the activities of p38 and JNK within 10 minutes and induce the phosphorylation of MKP-1 protein within approximately 5 minutes. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 19494320 |
Sentence Index: | 19494320_8 |
Sentence: | "The ERK inhibitor U0126 blocked Gln-induced MKP-1 phosphorylation and protein induction, as well as Gln's protective activity against endotoxic shock." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | D | EL4 thymoma | Phosphorylation | 10753946 |
T | 183 | U | Mammary tumor/carcinoma | Phosphorylation | 12754301 |
T | 188 | U | Heart failure | Phosphorylation | 19060905 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.