Id: acc3455
Group: 1sens
Protein: GSK3beta
Gene Symbol: Gsk3b
Protein Id: Q9WV60
Protein Name: GSK3B_MOUSE
PTM: phosphorylation
Site: Ser9
Site Sequence: -MSGRPRTTSFAESCKPVQQP
Disease Category: Cardiovascular and circulatory system diseases
Disease: Alcoholic Cardiomyopathy
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: ALDH2 transgene
Drug Info: ALDH2 transgene refers to a gene that is involved in the production of the ALDH2 enzyme. It may be used in gene - related therapies or research.
Relation:
ALDH2 transgene
GSK3beta-Ser9 DOWN
Alcoholic Cardiomyopathy Alleviate
Effect: modulate
Effect Info: Transgenic expression of ALDH2 alleviates disease symptoms and reduces the level of protein phosphorylation.
Note: Non-conventional drugs
Score: 3.0
Pubmed(PMID): 19332462
Sentence Index:
Sentence:

Sequence & Structure:

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: