Id: | acc3455 |
Group: | 1sens |
Protein: | GSK3beta |
Gene Symbol: | Gsk3b |
Protein Id: | Q9WV60 |
Protein Name: | GSK3B_MOUSE |
PTM: | phosphorylation |
Site: | Ser9 |
Site Sequence: | -MSGRPRTTSFAESCKPVQQP |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Alcoholic Cardiomyopathy |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | ALDH2 transgene |
Drug Info: | ALDH2 transgene refers to a gene that is involved in the production of the ALDH2 enzyme. It may be used in gene - related therapies or research. |
Relation: |
ALDH2 transgene
➜
GSK3beta-Ser9
DOWN
➜
Alcoholic Cardiomyopathy
Alleviate
|
Effect: | modulate |
Effect Info: | Transgenic expression of ALDH2 alleviates disease symptoms and reduces the level of protein phosphorylation. |
Note: | Non-conventional drugs |
Score: | 3.0 |
Pubmed(PMID): | 19332462 |
Sentence Index: | 19332462_9 |
Sentence: | "In addition, the ALDH2 transgene significantly attenuated chronic alcohol intake-induced myocardial fibrosis, protein carbonyl formation, apoptosis, enhanced NADPH oxidase p47(phox) and calcineurin expression, as well as phosphorylation of ASK-1, GSK-3beta, GATA4, and CREB." |
Sequence & Structure:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.