Id: | acc3402 |
Group: | 1sens |
Protein: | MLC |
Gene Symbol: | Myl1 |
Protein Id: | P02600 |
Protein Name: | MYL1_RAT |
PTM: | phosphorylation |
Site: | Ser19 |
Site Sequence: | PAAAAPAPAPAPAPAPAKPKE |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Hypertension |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Telmisartan |
Drug Info: | "Telmisartan is an angiotensin II receptor blocker used to treat high blood pressure. It helps to relax blood vessels and lower blood pressure, reducing the risk of heart attack and stroke." |
Relation: |
Telmisartan
➜
MLC-Ser19
DOWN
➜
Hypertension
Alleviate
|
Effect: | modulate |
Effect Info: | "Telmisartan improves vascular lesions through bidirectional regulation of phosphorylation events: it activates eNOS phosphorylation to promote vasodilation, and simultaneously inhibits the phosphorylation of myosin light chain (MLC) and MAPK/p70 S6 kinase, thereby alleviating vasoconstriction and fibrotic proliferation respectively." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 18437150 |
Sentence Index: | 18437150_2 |
Sentence: | "We investigate whether telmisartan improves cardiovascular remodeling associated with the production of endothelial nitric oxide synthase (eNOS) through PPAR-gamma, inhibits the Rho-kinase pathway, and suppresses oxidative stress in Dahl salt-sensitive (DS) hypertensive rats." |
Sequence & Structure:
MAPKKDVKKPAAAAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQEEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMMQAISNNKDQGGYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALLAGQEDSNGCINYEAFVKHIMSV
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.