Id: | acc3371 |
Group: | 1sens |
Protein: | ERK1 |
Gene Symbol: | MAPK3 |
Protein Id: | A0A1B0GUI7 |
Protein Name: | BRDOS_HUMAN |
PTM: | Phosphorylation |
Site: | Thr204 |
Site Sequence: | ----------------------------------------------------------------------------------------------------------------------------------- |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Myocardial Infarction |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | DADLE/Bradykinin |
Drug Info: | DADLE is a synthetic enkephalin analog with analgesic properties. Bradykinin is a peptide involved in vasodilation and inflammation. |
Relation: |
DADLE/Bradykinin
➜
ERK1-Thr204
UP
➜
Myocardial Infarction
Alleviate
|
Effect: | modulate |
Effect Info: | "Treatment of left ventricular myocardial tissue with DADLE promotes the increase of phosphorylation levels of Akt and ERK1/2 proteins, indicating the activation of these two signaling pathways, and significantly promotes myocardial survival in the rabbit myocardial infarction model (Disease)." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 17292392 |
Sentence Index: | 17292392_9 |
Sentence: | "Finally, DADLE increased phosphorylation of Akt and extracellular signal-regulated protein kinases (ERK) 1/2 in left ventricular myocardium, and this increase was blocked by the EGFR antagonist AG1478." |
Sequence & Structure:
MSGRVPLAEKALSEGYARLRYRDTSLLIWQQQQQKLESVPPGTYLSRSRSMWYSQYGNEAILVRDKNKLEVSRDTGQSKFCTIM
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.