| Id: | acc3349 |
| Group: | 1sens |
| Protein: | Rac |
| Gene Symbol: | RAC1 |
| Protein Id: | P63000 |
| Protein Name: | RAC1_HUMAN |
| PTM: | prenylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Diabetes Mellitus |
| Disease Subtype: | Diabetic Retinopathy |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Minodronate |
| Drug Info: | Minodronate is a drug used for the treatment of osteoporosis and other bone - related conditions. It can help suppress bone resorption and maintain bone density. |
| Relation: |
Minodronate
➜
Rac-unclear
DOWN
➜
Diabetes Mellitus
Alleviate
|
| Effect: | modulate |
| Effect Info: | "Minocycline inhibits ROS production by suppressing Rac isoprenylation, thereby inhibiting the AGE-RAGE signaling pathway and reducing the risk of retinopathy in diabetic patients." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 16216433 |
| Sentence Index: | 16216433_6 |
| Sentence: | "These observations let us to speculate that minodronate, a newly developed nitrogen-containing bisphosphonate, might be a promising remedy for treating patients with diabetic retinopathy by inhibiting the AGE-RAGE signaling pathways through suppression of ROS generation via inhibition of Rac prenylation." |
Sequence & Structure:
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
