Id: | acc3349 |
Group: | 1sens |
Protein: | Rac |
Gene Symbol: | RAC1 |
Protein Id: | P63000 |
Protein Name: | RAC1_HUMAN |
PTM: | prenylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Endocrine and metabolic diseases |
Disease: | Diabetes Mellitus |
Disease Subtype: | Diabetic Retinopathy |
Disease Cellline: | |
Disease Info: | |
Drug: | Minodronate |
Drug Info: | Minodronate is a drug used for the treatment of osteoporosis and other bone - related conditions. It can help suppress bone resorption and maintain bone density. |
Relation: |
Minodronate
➜
Rac-unclear
DOWN
➜
Diabetes Mellitus
Alleviate
|
Effect: | modulate |
Effect Info: | "Minocycline inhibits ROS production by suppressing Rac isoprenylation, thereby inhibiting the AGE-RAGE signaling pathway and reducing the risk of retinopathy in diabetic patients." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 16216433 |
Sentence Index: | 16216433_6 |
Sentence: | "These observations let us to speculate that minodronate, a newly developed nitrogen-containing bisphosphonate, might be a promising remedy for treating patients with diabetic retinopathy by inhibiting the AGE-RAGE signaling pathways through suppression of ROS generation via inhibition of Rac prenylation." |
Sequence & Structure:
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.