Id: | acc3324 |
Group: | 1sens |
Protein: | p38 MAPK |
Gene Symbol: | Mapk14 |
Protein Id: | P70618 |
Protein Name: | MK14_RAT |
PTM: | phosphorylation |
Site: | Thr180 |
Site Sequence: | LARHTDDEMTGYVATRWYRAP |
Disease Category: | Cell stress and damage |
Disease: | Cell Death |
Disease Subtype: | Hypoxia |
Disease Cellline: | H9c2 |
Disease Info: | |
Drug: | Rottlerin |
Drug Info: | Rottlerin is a natural compound that has been studied for its potential biological activities. |
Relation: |
Rottlerin
➜
p38 MAPK-Thr180
UP
➜
Cell Death
Alleviate
|
Effect: | modulate |
Effect Info: | "Under hypoxic stress conditions, Rottlerin can completely block the phosphorylation and activation of ERK, while significantly enhancing the phosphorylation of p38 MAPK." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 15631696 |
Sentence Index: | 15631696_6 |
Sentence: | "Treatment with rottlerin completely blocked the hypoxia-induced ERK phosphorylationation, whereas it significantly increased p38 MAPK phosphorylationation." |
Sequence & Structure:
MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.