| Id: | acc3319 |
| Group: | 1sens |
| Protein: | MLC20 |
| Gene Symbol: | Myl1 |
| Protein Id: | P02600 |
| Protein Name: | MYL1_RAT |
| PTM: | phosphorylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Cancer |
| Disease: | Laryngeal Cancer |
| Disease Subtype: | |
| Disease Cellline: | smooth muscle cell |
| Disease Info: | |
| Drug: | Nicotinamide |
| Drug Info: | "Nicotinamide, the biologically active amide of nicotinic acid (vitamin B3), serves as an essential precursor for the coenzymes nicotinamide adenine dinucleotide (NAD?) and nicotinamide adenine dinucleotide phosphate (NADP?), which are critical in cellular redox reactions and energy metabolism." |
| Relation: |
Nicotinamide
➜
MLC20-unclear
DOWN
➜
Laryngeal Cancer
Alleviate
|
| Effect: | modulate |
| Effect Info: | "Nicotinamide inhibits MLC20 phosphorylation, promotes vasodilation, and improves the cellular oxygenation state, thereby enhancing the efficacy of radiotherapy and chemotherapy." |
| Note: | ID not sure |
| Score: | 4.0 |
| Pubmed(PMID): | 15559762 |
| Sentence Index: | 15559762_6 |
| Sentence: | "We conclude that the vasorelaxant effects of nicotinamide are mediated mainly through inhibition of MLC20 phosphorylation, and that this could be a promising target for the development of novel tumor oxygenators to enhance radio- and chemotherapy." |
Sequence & Structure:
MAPKKDVKKPAAAAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQEEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMMQAISNNKDQGGYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALLAGQEDSNGCINYEAFVKHIMSV
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
