Id: acc3318
Group: 1sens
Protein: p38 MAP kinase
Gene Symbol: Mapk14
Protein Id: P70618
Protein Name: MK14_RAT
PTM: phosphorylation
Site: Tyr182
Site Sequence: RHTDDEMTGYVATRWYRAPEI
Disease Category: Cardiovascular and circulatory system diseases
Disease: Cardiac Myocyte Dysfunction
Disease Subtype: prenatally stressed (PS) rat
Disease Cellline:
Disease Info:
Drug: SB203580
Drug Info: "SB-203580 is a well - known drug often used in biochemical research, especially in studies related to signal transduction pathways."
Relation:
SB203580
p38 MAP kinase-Tyr182 DOWN
Cardiac Myocyte Dysfunction Alleviate
Effect: modulate
Effect Info: "The p38 mitogen-activated protein (MAP) kinase inhibitor SB-203580 blocked the phosphorylation of p38 MAP kinase, reversed the inhibition of fractional shortening, and partially alleviated the suppressed adrenergic signaling observed in adult rat ventricular myocytes treated with PS + R."
Note:
Score: 4.0
Pubmed(PMID): 15465893
Sentence Index:
Sentence:

Sequence & Structure:

MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: