Id: | acc3304 |
Group: | 1sens |
Protein: | p38 MAPK |
Gene Symbol: | MAPK14 |
Protein Id: | Q16539 |
Protein Name: | MK14_HUMAN |
PTM: | phosphorylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Respiratory system diseases |
Disease: | Airway Smooth Muscle Hyperplasia |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | SB203580 |
Drug Info: | SB 203580 is a well - known p38 mitogen - activated protein kinase inhibitor. It is often used in biological and medical research. |
Relation: |
SB203580
➜
p38 MAPK-unclear
DOWN
➜
Airway Smooth Muscle Hyperplasia
Alleviate
|
Effect: | modulate |
Effect Info: | "The p38MAPK inhibitor SB 203580 significantly inhibits the phosphorylation of p38MAPK and pRb induced by bFGF, thereby suppressing the cell cycle progression and proliferation. This suggests that p38MAPK plays a crucial role in bFGF-induced HASM proliferation." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 15249425 |
Sentence Index: | 15249425_8 |
Sentence: | "In addition, SB 203580 (10 microm) selectively inhibited bFGF-stimulated DNA synthesis, suggesting that the antimitogenic actions of SB 203580 on pRb phosphorylation cause cell cycle arrest at late G1 phase." |
Sequence & Structure:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
MAPK14 | ARRY-797 | MAP kinase p38 alpha inhibitor | 3 | Terminated | dilated cardiomyopathy | ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 3 | Completed | acute coronary syndrome | ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 3 | Terminated | COVID-19 | ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 3 | Active, not recruiting | Facioscapulohumeral dystrophy | ClinicalTrials |
MAPK14 | ACUMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials ClinicalTrials |
MAPK14 | SEMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | Crohn's disease | ClinicalTrials ClinicalTrials ClinicalTrials |
MAPK14 | PF-03715455 | MAP kinase p38 alpha inhibitor | 2 | Terminated | chronic obstructive pulmonary disease | ClinicalTrials |
MAPK14 | DILMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials |
MAPK14 | AZD-7624 | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials |
MAPK14 | SEMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Terminated | Crohn's disease | ClinicalTrials |
MAPK14 | PH-797804 | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials ClinicalTrials ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
MAPK14 | ARRY-797 | MAP kinase p38 alpha inhibitor | 2 | Completed | dilated cardiomyopathy | ClinicalTrials ClinicalTrials |
MAPK14 | DORAMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Terminated | rheumatoid arthritis | ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | BMS-582949 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials |
MAPK14 | DORAMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | psoriasis | ClinicalTrials |
MAPK14 | BMS-582949 | MAP kinase p38 alpha inhibitor | 2 | Completed | psoriasis | ClinicalTrials |
MAPK14 | DILMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | PG-760564 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials |
MAPK14 | TAK-715 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials |
MAPK14 | TALMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | PH-797804 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | VX-702 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | DILMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | coronary artery disease | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
MAPK14-Ser143 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | 0.707 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -0.707 |
MAPK14-Ser252 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.822 | ||||
COAD | |||||
HGSC | 2.685 | ||||
ccRCC | -0.234 | ||||
GBM | -0.193 | ||||
HNSC | 0.262 | ||||
LUAD | -0.258 | ||||
LUSC | -0.426 | ||||
non_ccRCC | 0.143 | ||||
PDAC | -0.484 | ||||
UCEC | -0.672 |
MAPK14-Ser32 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | -0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.707 |
MAPK14-Thr175 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | 0.659 | ||||
GBM | |||||
HNSC | -1.151 | ||||
LUAD | 0.492 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
MAPK14-Thr180 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 2.28 | ||||
COAD | 0.452 | ||||
HGSC | -1.055 | ||||
ccRCC | -0.189 | ||||
GBM | -0.187 | ||||
HNSC | 0.188 | ||||
LUAD | 0.929 | ||||
LUSC | 0.063 | ||||
non_ccRCC | -0.898 | ||||
PDAC | -0.317 | ||||
UCEC | -1.265 |
MAPK14-Thr185 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.707 | ||||
HGSC | -0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
MAPK14-Thr239 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | -0.707 | ||||
GBM | |||||
HNSC | 0.707 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
MAPK14-Thr241 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | 1.02 | ||||
ccRCC | -0.978 | ||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | -0.042 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
MAPK14-Tyr182 | |
---|---|
Cancer | Intensity |
BRCA | 2.374 |
COAD | -0.005 |
HGSC | -0.861 |
ccRCC | 0.066 |
GBM | 1.175 |
HNSC | -0.22 |
LUAD | 0.029 |
LUSC | -0.105 |
non_ccRCC | -0.927 |
PDAC | -0.488 |
UCEC | -1.039 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | P | Melanoma | Phosphorylation | 12114539 |
- | - | P | Pancreatic cancer/carcinoma/adenocarcinoma | Phosphorylation | 23712777 |
- | - | P | Colon cancer/carcinoma | Phosphorylation | 23799978 |
- | - | U | Breast cancer/tumor/carcinoma | Phosphorylation | 23539298 |
- | - | U | Lymphoma | Phosphorylation | 23620775 |
- | - | U | Bipolar disorder | Phosphorylation | 24075327 |
- | - | U | Parkinson's disease | Phosphorylation | 24405770 |
- | - | U | Alzheimer's disease | Phosphorylation | 24405770 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.