Id: | acc3267 |
Group: | 1sens |
Protein: | GSK3alpha |
Gene Symbol: | Gsk3a |
Protein Id: | P18265 |
Protein Name: | GSK3A_RAT |
PTM: | phosphorylation |
Site: | Ser21 |
Site Sequence: | GGSGRARTSSFAEPGGGGGGG |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Diabetes Mellitus |
Disease Subtype: | Diabetic Heart Disease |
Disease Cellline: | |
Disease Info: | |
Drug: | islet-transplanted |
Drug Info: | "“Islet - transplanted” refers to a process or state where islets have been transplanted. It is often related to medical treatments for diabetes, aiming to restore normal insulin - producing function." |
Relation: |
islet-transplanted
➜
GSK3alpha-Ser21
UP
➜
Diabetes Mellitus
Alleviate
|
Effect: | modulate |
Effect Info: | The phosphorylation level of GSK-3 in diabetic rats under insulin stimulation was significantly reduced and returned to the level of the control group after transplantation. |
Note: | Non-conventional drugs |
Score: | 3.0 |
Pubmed(PMID): | 11723053 |
Sentence Index: | 11723053_4 |
Sentence: | "Insulin-induced phosphorylation of Akt on Thr-308 was increased fivefold in diabetic heart, whereas Akt phosphorylation on Ser-473 was normal." |
Sequence & Structure:
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPSGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLIIPIIYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRSLGTQLPNNRPLPPLFNFSPGELSIQPSLNAILIPPHLRSPSGPATLTSSSQALTETQTGQDWQAPDATPTLTNSS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.