Id: | acc3232 |
Group: | 2sens_supp |
Protein: | p38 |
Gene Symbol: | Mapk14 |
Protein Id: | P70618 |
Protein Name: | MK14_RAT |
PTM: | Phosphorylation |
Site: | Tyr182 |
Site Sequence: | RHTDDEMTGYVATRWYRAPEI |
Disease Category: | Endocrine and metabolic diseases |
Disease: | Diabetes Mellitus |
Disease Subtype: | insulin resistance |
Disease Cellline: | |
Disease Info: | |
Drug: | Oleanolic acid |
Drug Info: | "Oleanolic acid is a naturally occurring triterpenoid compound with various pharmacological properties, such as anti - inflammatory and hepatoprotective effects." |
Relation: |
Oleanolic acid
➜
p38-Tyr182
UP
➜
Diabetes Mellitus
Alleviate
|
Effect: | modulate |
Effect Info: | OA regulates the phosphorylation of p38 MAPK and protects mitochondrial function. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 21254272 |
Sentence Index: | 21254272_7-8_supp |
Sentence: | "Oleanolic acid showed a significant blood glucose-lowering and weight-losing effect in diabetic animals induced by streptozotocin (STZ). In the insulin resistant model, it was also shown that OA may promote insulin signal transduction and inhibit oxidative stress-induced hepatic insulin resistance and gluconeogenesis, in which process the phosphorylation of ERK and the protective effect on mitochondrial function may be involved. These results indicated that OA could stimulate the hepatic insulin signal through enhancing the phosphorylation of Akt and inhibiting the phosphorylation of mTOR." |
Sequence & Structure:
MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.