Id: | acc3206 |
Group: | 2sens |
Protein: | HMGB1 |
Gene Symbol: | HMGB1 |
Protein Id: | P09429 |
Protein Name: | HMGB1_HUMAN |
PTM: | acetylation |
Site: | Lys29 |
Site Sequence: | VQTCREEHKKKHPDASVNFSE |
Disease Category: | Immune system diseases |
Disease: | Kidney Damage |
Disease Subtype: | TCE-induced immune kidney damage |
Disease Cellline: | |
Disease Info: | |
Drug: | FPS–ZM 1 |
Drug Info: | "FPS–ZM 1 is a specific drug, but no detailed information about its properties is provided in the given text." |
Relation: |
FPS–ZM 1
➜
HMGB1-Lys29
DOWN
➜
Kidney Damage
Alleviate
|
Effect: | modulate |
Effect Info: | The drug inhibited protein acetylation and alleviated podocyte damage. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 37216866 |
Sentence Index: | 37216866_0-1 |
Sentence: | HMGB 1 acetylation mediates trichloroethylene-induced immune kidney injury by facilitating endothelial cell-podocyte communication. More and more clinical evidence shows that occupational medicamentose-like dermatitis due to trichloroethylene (OMDT) patients often present immune kidney damage. |
Sequence & Structure:
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
HMGB1 | CD24FC | High mobility group protein B1 inhibitor | 3 | Completed | COVID-19 | ClinicalTrials |
HMGB1 | CD24FC | High mobility group protein B1 inhibitor | 1 | Terminated | neoplasm | ClinicalTrials |
HMGB1 | CD24FC | High mobility group protein B1 inhibitor | 1 | Withdrawn | metastatic melanoma | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACHMGB1-Lys29 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | |
GBM | |
HNSC | |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
K | 29 | D | Sepsis-associated acute kidney injury | Acetylation | 30379096 |
K | 29 | U | Sepsis | Acetylation | 34363018 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.