Id: acc3167
Group: 2sens
Protein: ERK2
Gene Symbol: Mapk1
Protein Id: P63085
Protein Name: MK01_MOUSE
PTM: phosphorylation
Site: Tyr187
Site Sequence: HTGFLTEYVATRWYRAPEIML
Disease Category: Endocrine and metabolic diseases
Disease: Thiamine Deficiency
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: Thiamine + Trolox
Drug Info: "Thiamine is an essential vitamin also known as vitamin B1, which plays a crucial role in energy metabolism | Trolox is a water - soluble analog of vitamin E with antioxidant properties. "
Relation:
Thiamine + Trolox
ERK2-Tyr187 DOWN
Thiamine Deficiency Alleviate
Effect: modulate
Effect Info: "Thiamine deficiency causes animals to exhibit declines in motor ability and spatial memory in terms of behavior and neuropathology, and treatment with vitamin B1 in combination with Trolox or DMSO can alleviate or reverse these effects. In addition, ERK1/2 phosphorylation increases significantly after experiencing thiamine deficiency (TD), and the recovery effect is better when receiving the combination therapy. "
Note: drug comb
Score: 4.0
Pubmed(PMID): 34468817
Sentence Index:
Sentence:

Sequence & Structure:

MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
- - D EL4 thymoma Phosphorylation 10753946
T 183 U Mammary tumor/carcinoma Phosphorylation 12754301
T 188 U Heart failure Phosphorylation 19060905

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: