Id: | acc3167 |
Group: | 2sens |
Protein: | ERK2 |
Gene Symbol: | Mapk1 |
Protein Id: | P63085 |
Protein Name: | MK01_MOUSE |
PTM: | phosphorylation |
Site: | Tyr187 |
Site Sequence: | HTGFLTEYVATRWYRAPEIML |
Disease Category: | Endocrine and metabolic diseases |
Disease: | Thiamine Deficiency |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Thiamine + Trolox |
Drug Info: | "Thiamine is an essential vitamin also known as vitamin B1, which plays a crucial role in energy metabolism | Trolox is a water - soluble analog of vitamin E with antioxidant properties. " |
Relation: |
Thiamine + Trolox
➜
ERK2-Tyr187
DOWN
➜
Thiamine Deficiency
Alleviate
|
Effect: | modulate |
Effect Info: | "Thiamine deficiency causes animals to exhibit declines in motor ability and spatial memory in terms of behavior and neuropathology, and treatment with vitamin B1 in combination with Trolox or DMSO can alleviate or reverse these effects. In addition, ERK1/2 phosphorylation increases significantly after experiencing thiamine deficiency (TD), and the recovery effect is better when receiving the combination therapy. " |
Note: | drug comb |
Score: | 4.0 |
Pubmed(PMID): | 34468817 |
Sentence Index: | 34468817_9-10 |
Sentence: | "Deficient animals showed a strong increase in ERK1/2 phosphorylation in the thalamus, hippocampus, and cerebral cortex after one deficiency episode and recovery. Interestingly, after recurrent TD and recovery, ERK1/2 phosphorylation remained high only in the deficient mice treated with thiamine and/or Trolox or thiamine with DMSO." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | D | EL4 thymoma | Phosphorylation | 10753946 |
T | 183 | U | Mammary tumor/carcinoma | Phosphorylation | 12754301 |
T | 188 | U | Heart failure | Phosphorylation | 19060905 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.