Id: | acc3101 |
Group: | 2sens |
Protein: | ERK2 |
Gene Symbol: | Mapk1 |
Protein Id: | P63085 |
Protein Name: | MK01_MOUSE |
PTM: | phosphorylation |
Site: | Tyr187 |
Site Sequence: | HTGFLTEYVATRWYRAPEIML |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Abdominal Aortic Aneurysm |
Disease Subtype: | angiotensin II- (AngII-) induced |
Disease Cellline: | |
Disease Info: | |
Drug: | Simvastatin |
Drug Info: | Simvastatin is a lipid - lowering drug commonly used to reduce cholesterol levels and decrease the risk of cardiovascular diseases. |
Relation: |
Simvastatin
➜
ERK2-Tyr187
DOWN
➜
Abdominal Aortic Aneurysm
Alleviate
|
Effect: | modulate |
Effect Info: | "AngII induces enhanced ERK phosphorylation, promoting inflammation and vascular wall remodeling. Simvastatin can significantly inhibit ERK phosphorylation and slow down the formation of AAA." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 32617140 |
Sentence Index: | 32617140_12-13 |
Sentence: | "Simvastatin-affected parameters that differed between the healthy structure of the aorta and aneurysmal tissue included immune cell infiltration of the aortic wall, VCAM1 mRNA and protein level, extracellular matrix degradation, TGF-beta1 mRNA level, and ERK phosphorylation, but neither oxidative stress nor the level of Angiotensin II Type 1 Receptor (AT1R). Taken together, the inhibition of Nrf2 transcriptional activity facilitates AAA formation in mice, which can be prevented by simvastatin." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | D | EL4 thymoma | Phosphorylation | 10753946 |
T | 183 | U | Mammary tumor/carcinoma | Phosphorylation | 12754301 |
T | 188 | U | Heart failure | Phosphorylation | 19060905 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.