Id: | acc3035 |
Group: | 2sens |
Protein: | c-Jun |
Gene Symbol: | JUN |
Protein Id: | P05412 |
Protein Name: | JUN_HUMAN |
PTM: | phosphorylation |
Site: | Ser73 |
Site Sequence: | PDVGLLKLASPELERLIIQSS |
Disease Category: | Cancer |
Disease: | Breast Cancer |
Disease Subtype: | |
Disease Cellline: | MCF-7 |
Disease Info: | |
Drug: | BIX-01294 |
Drug Info: | "BIX - 01294 is a chemical compound used in biological research, often in epigenetic studies." |
Relation: |
BIX-01294
➜
c-Jun-Ser73
UP
➜
Breast Cancer
Alleviate
|
Effect: | modulate |
Effect Info: | "BIX - 01294 induces the phosphorylation of c - Jun, but the phosphorylation level decreases after combined treatment with TRAIL, suggesting the regulation of the activities of different signaling pathways." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 29964331 |
Sentence Index: | 29964331_2-3 |
Sentence: | "However, breast cancer cells are generally resistant to TRAIL, thus limiting its therapeutic potential. In this study, we found that BIX-01294, a selective inhibitor of euchromatin histone methyltransferase 2/G9a, is a strong TRAIL sensitizer in breast cancer cells." |
Sequence & Structure:
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACJUN-Ser73 | |
---|---|
Cancer | Intensity |
BRCA | 0.843 |
COAD | 0.239 |
HGSC | -1.97 |
ccRCC | 0.005 |
GBM | 0.608 |
HNSC | -0.034 |
LUAD | 1.467 |
LUSC | 0.741 |
non_ccRCC | -0.211 |
PDAC | -0.21 |
UCEC | -1.479 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 73 | U | Classical Hodgkin lymphoma | Phosphorylation | 24457077 |
S | 73 | U | Colorectal cancer | Phosphorylation | 21296766 |
S | 73 | U | Gallbladder cancer | Phosphorylation | 34703881 |
S | 73 | U | Melanoma | Phosphorylation | 17001009 |
S | 73 | U | Ovarian cancer/carcinoma | Phosphorylation | 17001009 |
S | 73 | U | Glioblastoma | Phosphorylation | 35567901 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.