Id: acc3034
Group: 2sens
Protein: c-Jun
Gene Symbol: JUN
Protein Id: P05412
Protein Name: JUN_HUMAN
PTM: phosphorylation
Site: Ser73
Site Sequence: PDVGLLKLASPELERLIIQSS
Disease Category: Cancer
Disease: Breast Cancer
Disease Subtype:
Disease Cellline: MCF-7
Disease Info:
Drug: TRAIL + BIX-01294
Drug Info: TRAIL is a cytokine that can induce apoptosis in cancer cells | BIX - 01294 is a histone methyltransferase G9a inhibitor.
Relation:
TRAIL + BIX-01294
c-Jun-Ser73 DOWN
Breast Cancer Alleviate
Effect: modulate
Effect Info: "BIX - 01294 induces the phosphorylation of c - Jun, but the phosphorylation level decreases after combined treatment with TRAIL, suggesting the regulation of the activities of different signaling pathways."
Note: "drug comb, Non-conventional drugs"
Score: 4.0
Pubmed(PMID): 29964331
Sentence Index:
Sentence:

Sequence & Structure:

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC
JUN-Ser73
Cancer Intensity
BRCA 0.843
COAD 0.239
HGSC -1.97
ccRCC 0.005
GBM 0.608
HNSC -0.034
LUAD 1.467
LUSC 0.741
non_ccRCC -0.211
PDAC -0.21
UCEC -1.479

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
S 73 U Classical Hodgkin lymphoma Phosphorylation 24457077
S 73 U Colorectal cancer Phosphorylation 21296766
S 73 U Gallbladder cancer Phosphorylation 34703881
S 73 U Melanoma Phosphorylation 17001009
S 73 U Ovarian cancer/carcinoma Phosphorylation 17001009
S 73 U Glioblastoma Phosphorylation 35567901

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: