Id: | acc2562 |
Group: | 2sens |
Protein: | Trx1 |
Gene Symbol: | TXN |
Protein Id: | P10599 |
Protein Name: | THIO_HUMAN |
PTM: | oxidation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Cancer |
Disease: | Prostate Cancer |
Disease Subtype: | |
Disease Cellline: | PC3 |
Disease Info: | |
Drug: | 2DG + Au |
Drug Info: | "2-Deoxy-D-glucose (2-DG) is a glucose analog that inhibits glycolysis, leading to potential applications in cancer therapy and imaging. Auranofin is an orally administered gold compound traditionally used to treat rheumatoid arthritis, and it has also been investigated for its anticancer properties. " |
Relation: |
Trx1-unclear
UP
+
2DG + Au
➜
Prostate Cancer
Alleviate
|
Effect: | enhance |
Effect Info: | Protein oxidation promotes the anti - cancer effect of drugs. |
Note: | |
Score: | 5.0 |
Pubmed(PMID): | 25560241 |
Sentence Index: | 25560241_5-6 |
Sentence: | "Redox Western blot analysis of PC-3 cells also supported the conclusion that thioredoxin-1 (Trx-1) oxidation was enhanced by treatment DHEA+Au and inhibited by NAC. Importantly, normal human mammary epithelial cells (HMEC) were not as sensitive to 2DG, DHEA, and Au combinations as their cancer cell counterparts (MDA-MB-231)." |
Sequence & Structure:
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
TXN | PX-12 | Thioredoxin inhibitor | 2 | Terminated | pancreatic neoplasm | ClinicalTrials |
TXN | PX-12 | Thioredoxin inhibitor | 1 | Completed | cancer | ClinicalTrials |
TXN | PX-12 | Thioredoxin inhibitor | 1 | Completed | metastatic malignant neoplasm | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.