Id: | acc2544 |
Group: | 2sens |
Protein: | MKP-1 |
Gene Symbol: | DUSP14 |
Protein Id: | O95147 |
Protein Name: | DUS14_HUMAN |
PTM: | S-nitrosylation |
Site: | Cys258 |
Site Sequence: | ----------------------------------------------------------------------- |
Disease Category: | Cancer |
Disease: | Head and Neck Cancer |
Disease Subtype: | HNSCC |
Disease Cellline: | MDA-1483 |
Disease Info: | |
Drug: | Radiotherapy |
Drug Info: | - |
Relation: |
MKP-1-Cys258
UP
+
Radiotherapy
➜
Head and Neck Cancer
Aggravate
|
Effect: | decrease |
Effect Info: | S-nitrosylation of proteins reduces the sensitivity to radiotherapy. |
Note: | Non-conventional drugs |
Score: | 4.5 |
Pubmed(PMID): | 22014408 |
Sentence Index: | 22014408_4-5 |
Sentence: | "Here we show that S-nitrosylation of MKP-1 on Cysteine 258 enhances MKP-1 protein stability, phosphatase activity, and MKP-1-mediated anti-apoptotic effect on HNC radiotherapy. Co-culturing MKP-1 transfected HNC cell lines with activated macrophages for mimicking the microenvironment of the irradiated cancer cells further confirms that S-nitrosylation-mediated increase of MKP-1 activity correlates with decrease of HNC radiosensitivity." |
Sequence & Structure:
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.