Id: acc2518
Group: 2sens
Protein: LIP
Gene Symbol: Cebpb
Protein Id: P28033
Protein Name: CEBPB_MOUSE
PTM: ubiquitination
Site: unclear
Site Sequence:
Disease Category: Cancer
Disease: Mesothelioma
Disease Subtype: malignant pleural mesothelioma (MPM)
Disease Cellline: AB1?
Disease Info:
Drug: Cisplatin
Drug Info: "Cisplatin is a platinum-based chemotherapeutic agent widely used in the treatment of various malignancies, including ovarian, bladder, testicular, and non-small cell lung cancers, by forming DNA cross-links to interfere with replication and repair, thereby inhibiting cancer cell growth and proliferation."
Relation:
LIP-unclear UP
Cisplatin
Mesothelioma Alleviate
Effect: sensitize
Effect Info: LIP ubiquitination is directly associated with cisplatin chemotherapy sensitivity and is related to the survival rate of patients after chemotherapy.
Note:
Score: 5.0
Pubmed(PMID): 29748013
Sentence Index:
Sentence:

Sequence & Structure:

MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERAIDFSPYLEPLAPAADFAAPAPAHHDFLSDLFADDYGAKPSKKPADYGYVSLGRAGAKAAPPACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLSTSSSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKTVDKLSDEYKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
T 188 U Lung cancer Phosphorylation 21847090

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: