Id: | acc2518 |
Group: | 2sens |
Protein: | LIP |
Gene Symbol: | Cebpb |
Protein Id: | P28033 |
Protein Name: | CEBPB_MOUSE |
PTM: | ubiquitination |
Site: | unclear |
Site Sequence: | |
Disease Category: | Cancer |
Disease: | Mesothelioma |
Disease Subtype: | malignant pleural mesothelioma (MPM) |
Disease Cellline: | AB1? |
Disease Info: | |
Drug: | Cisplatin |
Drug Info: | "Cisplatin is a platinum-based chemotherapeutic agent widely used in the treatment of various malignancies, including ovarian, bladder, testicular, and non-small cell lung cancers, by forming DNA cross-links to interfere with replication and repair, thereby inhibiting cancer cell growth and proliferation." |
Relation: |
LIP-unclear
UP
+
Cisplatin
➜
Mesothelioma
Alleviate
|
Effect: | sensitize |
Effect Info: | LIP ubiquitination is directly associated with cisplatin chemotherapy sensitivity and is related to the survival rate of patients after chemotherapy. |
Note: | |
Score: | 5.0 |
Pubmed(PMID): | 29748013 |
Sentence Index: | 29748013_8-9 |
Sentence: | We found that LIP was degraded by constitutive ubiquitination in primary MPM cells derived from patients poorly responsive to cisplatin. LIP ubiquitination was directly correlated with cisplatin chemosensitivity and was associated with patients' survival after chemotherapy. |
Sequence & Structure:
MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERAIDFSPYLEPLAPAADFAAPAPAHHDFLSDLFADDYGAKPSKKPADYGYVSLGRAGAKAAPPACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLSTSSSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKTVDKLSDEYKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
T | 188 | U | Lung cancer | Phosphorylation | 21847090 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.