Id: acc2414
Group: 2sens
Protein: BCL2
Gene Symbol: Bcl2
Protein Id: P10417
Protein Name: BCL2_MOUSE
PTM: phosphorylation
Site: unclear
Site Sequence:
Disease Category: Cancer
Disease: Lung Cancer
Disease Subtype:
Disease Cellline: LKR
Disease Info:
Drug: Cisplatin
Drug Info: "Cisplatin is a platinum-based chemotherapeutic agent widely used in the treatment of various malignancies, including ovarian, bladder, testicular, and non-small cell lung cancers, by forming DNA cross-links to interfere with replication and repair, thereby inhibiting cancer cell growth and proliferation."
Relation:
BCL2-unclear DOWN
Cisplatin
Lung Cancer Aggravate
Effect: increase
Effect Info: "Nicotine reduces the ubiquitination and degradation of Bcl - 2, thereby reducing the sensitivity of lung cancer cells to cisplatin."
Note:
Score: 5.0
Pubmed(PMID): 24548862
Sentence Index:
Sentence:

Sequence & Structure:

MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: