Id: | acc2410 |
Group: | 2sens |
Protein: | YAP |
Gene Symbol: | YAP1 |
Protein Id: | P46937 |
Protein Name: | YAP1_HUMAN |
PTM: | phosphorylation |
Site: | Ser127 |
Site Sequence: | LTPQHVRAHSSPASLQLGAVS |
Disease Category: | Cancer |
Disease: | Pancreas Cancer |
Disease Subtype: | |
Disease Cellline: | PANC-1 |
Disease Info: | |
Drug: | Gemcitabine |
Drug Info: | "Gemcitabine is a pyrimidine nucleoside analog antimetabolite and antineoplastic agent that inhibits DNA synthesis and repair, leading to autophagy and apoptosis, and is used in the treatment of various solid tumors including non-small cell lung cancer, pancreatic cancer, breast cancer, and ovarian cancer. " |
Relation: |
YAP-Ser127
DOWN
+
Gemcitabine
➜
Pancreas Cancer
Alleviate
|
Effect: | decrease |
Effect Info: | Drugs can enhance the sensitivity of PC cells to gemcitabine by inducing the phosphorylation of YAP Ser127 through the down - regulation of AMPK. |
Note: | |
Score: | 5.0 |
Pubmed(PMID): | 31627466 |
Sentence Index: | 31627466_4-5 |
Sentence: | "Here, we show that nuciferine could enhance the sensitivity of PC cells to gemcitabine in both cultured cells and the xenograft mouse model. The mechanism study demonstrated that nuciferine induced YAP Ser127 phosphorylation [pYAP(Ser127)] through AMPK-mediated 3-hydroxy-3-methyl-glutaryl-coA reductase (HMGCR) downregulation." |
Sequence & Structure:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACYAP1-Ser127 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | 0.729 |
HGSC | -1.387 |
ccRCC | |
GBM | |
HNSC | 0.735 |
LUAD | -0.077 |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 127 | A | Hepatocellular carcinoma/hepatocarcinoma/hepatoma | Phosphorylation | 22761457 |
S | 127 | A | Adult T-cell leukemia/lymphoma | Phosphorylation | 35210364 |
S | 127 | D | Bladder cancer | Phosphorylation | 26119935 |
S | 127 | D | Glioblastoma | Phosphorylation | 34343153 |
S | 127 | D | Prostate cancer | Phosphorylation | 36823643 |
S | 127 | D | Lung cancer/carcinoma | Phosphorylation | 21060948 |
S | 127 | D | Renal cell carcinoma | Phosphorylation | 32926756 |
S | 127 | D | Liver cancer | Phosphorylation | 28474680 |
S | 127 | D | Diabetes mellitus | Phosphorylation | 28474680 |
S | 127 | D | Coronary artery disease | Phosphorylation | 37104914 |
S | 127 | P | Cervical cancer/carcinoma | Phosphorylation | 23027127 |
S | 127 | P | Hepatocellular cancer | Phosphorylation | 35597479 |
S | 127 | P | Colon cancer | Phosphorylation | 34206989 |
S | 127 | U | Hepatocellular cancer | Phosphorylation | 35586495 |
S | 127 | U | Parkinson's disease | Phosphorylation | 32929029 |
S | 127 | U | Osteoarthritis | Phosphorylation | 37100374 |
S | 127 | U | Breast cancer | Phosphorylation | 36774339 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.