Id: | acc2262 |
Group: | 2sens |
Protein: | PP2A |
Gene Symbol: | PTPA |
Protein Id: | Q15257 |
Protein Name: | PTPA_HUMAN |
PTM: | phosphorylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Cancer |
Disease: | Colorectal Cancer |
Disease Subtype: | |
Disease Cellline: | HT29 |
Disease Info: | |
Drug: | Resveratrol |
Drug Info: | "Resveratrol (Res) is a natural polyphenolic stilbene compound (C<sub>14</sub>H<sub>12</sub>O<sub>3</sub>) found in plants such as grapes, Polygonum cuspidatum, and peanuts, exhibiting antioxidant, anti-inflammatory, cardioprotective, and anticancer properties through mechanisms including SIRT1 activation and inhibition of cancer cell proliferation. ." |
Relation: |
Resveratrol
➜
PP2A-unclear
UP
➜
Colorectal Cancer
Alleviate
|
Effect: | modulate |
Effect Info: | Resveratrol inhibits Erk1/2-mediated cancer cell adhesion by activating the PP2A/PTEN signaling network without reducing cell viability or the number of viable cells. Inhibition of Erk1/2 by U0126 can promote this process. |
Note: | no tumor effct |
Score: | 3.0 |
Pubmed(PMID): | 30066962 |
Sentence Index: | 30066962_4-5 |
Sentence: | "Here, we show that resveratrol suppressed the basal or type I insulin-like growth factor (IGF)-1-stimulated adhesion of cancer cells (Rh1, Rh30, HT29, and HeLa cells) by inhibiting the extracellular signal-regulated kinase 1/2 (Erk1/2) pathway. Inhibition of Erk1/2 with U0126, knockdown of Erk1/2, or overexpression of dominant-negative mitogen-activated protein kinase kinase 1 (MKK1) strengthened resveratrol's inhibition of the basal or IGF-1-stimulated of Erk1/2 phosphorylation and cell adhesion, whereas ectopic expression of constitutively active MKK1 attenuated the inhibitory effects of resveratrol." |
Sequence & Structure:
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.