Id: acc2259
Group: 2sens
Protein: PP2A
Gene Symbol: PTPA
Protein Id: Q15257
Protein Name: PTPA_HUMAN
PTM: phosphorylation
Site: unclear
Site Sequence:
Disease Category: Cancer
Disease: Sarcoma
Disease Subtype: Ewing sarcoma
Disease Cellline: Rh1
Disease Info:
Drug: Resveratrol
Drug Info: "Resveratrol (Res) is a natural polyphenolic stilbene compound (C<sub>14</sub>H<sub>12</sub>O<sub>3</sub>) found in plants such as grapes, Polygonum cuspidatum, and peanuts, exhibiting antioxidant, anti-inflammatory, cardioprotective, and anticancer properties through mechanisms including SIRT1 activation and inhibition of cancer cell proliferation. ."
Relation:
Resveratrol
PP2A-unclear UP
Sarcoma Alleviate
Effect: modulate
Effect Info: Resveratrol inhibits Erk1/2-mediated cancer cell adhesion by activating the PP2A/PTEN signaling network without reducing cell viability or the number of viable cells. Inhibition of Erk1/2 by U0126 can promote this process.
Note: no tumor effct
Score: 3.0
Pubmed(PMID): 30066962
Sentence Index:
Sentence:

Sequence & Structure:

MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: