Id: | acc2187 |
Group: | 2sens |
Protein: | Hsp27 |
Gene Symbol: | HSPB1 |
Protein Id: | P04792 |
Protein Name: | HSPB1_HUMAN |
PTM: | phosphorylation |
Site: | Ser78 |
Site Sequence: | AAPAYSRALSRQLSSGVSEIR |
Disease Category: | Cancer |
Disease: | Leukemia |
Disease Subtype: | mononuclear cell leukemia |
Disease Cellline: | THP-1 |
Disease Info: | |
Drug: | Apigenin |
Drug Info: | "Apigenin is a naturally occurring flavonoid compound with demonstrated potential as an antifungal agent in the preparation of drugs against human fungal infections, and it is also being researched in drug delivery systems such as solid lipid nanoparticles (APG-SLNP) to enhance stability and bioavailability. " |
Relation: |
Hsp27-Ser78
UP
+
Apigenin
➜
Leukemia
Alleviate
|
Effect: | increase |
Effect Info: | Phosphorylation of Hsp27 significantly increases the sensitivity of leukemia cells to apigenin-induced apoptosis. |
Note: | |
Score: | 5.0 |
Pubmed(PMID): | 21364669 |
Sentence Index: | 21364669_9-10 |
Sentence: | "In addition, we found that apigenin-induced PKCdelta activity is mediated by p38. We also showed that the phosphorylation of Hsp27 significantly increased the susceptibility of leukemia cells to apigenin-induced apoptosis." |
Sequence & Structure:
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 2 | Unknown status | squamous cell lung carcinoma | ClinicalTrials |
HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 2 | Completed | pancreatic carcinoma | ClinicalTrials |
HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 2 | Completed | non-small cell lung carcinoma | ClinicalTrials |
HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 2 | Completed | prostate cancer | ClinicalTrials |
HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 2 | Terminated | prostate cancer | ClinicalTrials |
HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 1 | Completed | neoplasm | ClinicalTrials |
HSPB1 | APATORSEN | Heat shock protein beta-1 (HSP27) mRNA antisense inhibitor | 1 | Unknown status | urinary bladder cancer | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACHSPB1-Ser78 | |
---|---|
Cancer | Intensity |
BRCA | 0.707 |
COAD | |
HGSC | |
ccRCC | -0.707 |
GBM | |
HNSC | |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 78 | N | Dilated cardiomyopathy | Phosphorylation | 34477462 |
S | 78 | P | Pancreatic cancer/carcinoma/adenocarcinoma | Phosphorylation | 22012255 |
S | 78 | U | Breast cancer/tumor/carcinoma | Phosphorylation | 17697330 |
S | 78 | U | Head and neck squamous cell carcinoma | Phosphorylation | 34498800 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.