Id: | acc2127 |
Group: | 2sens |
Protein: | p36 |
Gene Symbol: | Nt5c3a |
Protein Id: | Q9D020 |
Protein Name: | 5NT3A_MOUSE |
PTM: | phosphorylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Cancer |
Disease: | Lung Cancer |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Butylated hydroxytoluene (BHT) |
Drug Info: | "Butylated hydroxytoluene (BHT) is a synthetic antioxidant primarily used in food, cosmetics, and industrial products to prevent oxidative degradation of fats, oils, and polymers, and it also exhibits inhibitory activity against ferroptosis." |
Relation: |
p36-unclear
DOWN
+
Butylated hydroxytoluene (BHT)
➜
Lung Cancer
Alleviate
|
Effect: | inhibit |
Effect Info: | "The phosphorylation level of p36 decreased after drug treatment, and the phosphorylation level of p36 was negatively correlated with the degree of pulmonary cell proliferation." |
Note: | bidirectional regulatory effect |
Score: | 4.5 |
Pubmed(PMID): | 4053047 |
Sentence Index: | 4053047_15-16 |
Sentence: | P36 phosphorylation also decreased when mice were given multiple BHT injections over a period of 5 weeks. These results are consistent with a hypothesis that decreased Pk-C-dependent phosphorylation of p36 is involved in lung tumor modulation by BHT. |
Sequence & Structure:
MDRAAVARVGAVASASVCAVVAGVVLAQYIFTLKRKTGRKTKIIEMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.