Id: | acc1927 |
Group: | 2sens |
Protein: | BCL2 |
Gene Symbol: | BCL2 |
Protein Id: | P10415 |
Protein Name: | BCL2_HUMAN |
PTM: | phosphorylation |
Site: | Ser70 |
Site Sequence: | ASRDPVARTSPLQTPAAPGAA |
Disease Category: | Cancer |
Disease: | Ovarian Cancer |
Disease Subtype: | |
Disease Cellline: | OV2008 |
Disease Info: | |
Drug: | Paclitaxel |
Drug Info: | "Paclitaxel is a plant-derived alkaloid and potent antineoplastic agent that stabilizes microtubules to inhibit cancer cell division, primarily used in the treatment of ovarian, breast, and lung cancers. " |
Relation: |
BCL2-Ser70
DOWN
+
Paclitaxel
➜
Ovarian Cancer
Aggravate
|
Effect: | enhance |
Effect Info: | "Carboplatin inhibits paclitaxel-induced Bcl-2 phosphorylation, thereby resulting in antagonistic resistance." |
Note: | site unclear |
Score: | 5.0 |
Pubmed(PMID): | 17568189 |
Sentence Index: | 17568189_4-5 |
Sentence: | "The combination of carboplatin and paclitaxel resulted in antagonistic interactions when tumor cells were exposed to carboplatin prior to paclitaxel or exposed to the two drugs simultaneously, but there was little antagonistic interaction observed when paclitaxel was administered before carboplatin. Biochemical examination revealed that pretreatment or cotreatment of carboplatin inhibited paclitaxel-induced IkappaBalpha degradation and bcl-2 phosphorylation." |
Sequence & Structure:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 4 | - | chronic lymphocytic leukemia | EMA DailyMed FDA |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 4 | Not yet recruiting | chronic lymphocytic leukemia | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 4 | - | neoplasm | ATC |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Completed | chronic lymphocytic leukemia | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Not yet recruiting | chronic lymphocytic leukemia | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Recruiting | chronic lymphocytic leukemia | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | chronic lymphocytic leukemia | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | acute myeloid leukemia | ClinicalTrials ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Completed | acute myeloid leukemia | ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Not yet recruiting | acute myeloid leukemia | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | myelodysplastic syndrome | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Recruiting | acute myeloid leukemia | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Terminated | acute myeloid leukemia | ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | childhood acute myeloid leukemia | ClinicalTrials |
BCL2 | OBLIMERSEN SODIUM | Bcl-2 mRNA antisense inhibitor | 3 | Completed | cutaneous melanoma | ClinicalTrials |
BCL2 | OBLIMERSEN SODIUM | Bcl-2 mRNA antisense inhibitor | 3 | Completed | leukemia | ClinicalTrials |
BCL2 | OBATOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Withdrawn | small cell lung carcinoma | ClinicalTrials |
BCL2 | OBATOCLAX MESYLATE | Apoptosis regulator Bcl-2 inhibitor | 3 | Withdrawn | small cell lung carcinoma | ClinicalTrials |
BCL2 | OBLIMERSEN SODIUM | Bcl-2 mRNA antisense inhibitor | 3 | Completed | multiple myeloma | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | multiple myeloma | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Completed | multiple myeloma | ClinicalTrials |
BCL2 | NAVITOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | primary myelofibrosis | ClinicalTrials ClinicalTrials |
BCL2 | OBLIMERSEN SODIUM | Bcl-2 mRNA antisense inhibitor | 3 | Withdrawn | lymphoid leukemia | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Completed | Mantle cell lymphoma | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Recruiting | cancer | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
BCL2L11-Ser104 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | 0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -0.707 |
BCL2L11-Ser118 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | 0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | -0.707 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L11-Ser77 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.869 | ||||
COAD | |||||
HGSC | 1.655 | ||||
ccRCC | 0.169 | ||||
GBM | |||||
HNSC | 0.422 | ||||
LUAD | 0.134 | ||||
LUSC | -0.138 | ||||
non_ccRCC | 0.29 | ||||
PDAC | |||||
UCEC | -0.663 |
BCL2L11-Ser92 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | -0.707 | ||||
LUAD | 0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L11-Ser93 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | -0.707 | ||||
LUAD | 0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L11-Ser94 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.664 | ||||
COAD | |||||
HGSC | 1.002 | ||||
ccRCC | -0.246 | ||||
GBM | |||||
HNSC | -0.477 | ||||
LUAD | 0.629 | ||||
LUSC | -0.105 | ||||
non_ccRCC | 1.47 | ||||
PDAC | |||||
UCEC | -0.61 |
BCL2L12-Ser113 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.987 | ||||
COAD | |||||
HGSC | |||||
ccRCC | -0.026 | ||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 1.013 |
BCL2L12-Ser121 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.134 | ||||
COAD | |||||
HGSC | 1.006 | ||||
ccRCC | 0.652 | ||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -0.524 |
BCL2L12-Ser194 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | 0.153 | ||||
LUAD | 0.915 | ||||
LUSC | -1.068 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L12-Ser195 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.374 | ||||
COAD | |||||
HGSC | |||||
ccRCC | -1.133 | ||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.759 |
BCL2L12-Ser241 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | -0.993 | ||||
HGSC | |||||
ccRCC | |||||
GBM | 1.084 | ||||
HNSC | -0.554 | ||||
LUAD | 1.075 | ||||
LUSC | -0.613 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L12-Ser242 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | -0.42 | ||||
HGSC | -1.185 | ||||
ccRCC | -0.19 | ||||
GBM | |||||
HNSC | 0.276 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 1.519 |
BCL2L12-Ser272 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | -0.088 | ||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | 0.237 | ||||
LUAD | -1.365 | ||||
LUSC | -0.208 | ||||
non_ccRCC | |||||
PDAC | 1.424 | ||||
UCEC |
BCL2L12-Ser273 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.524 | ||||
COAD | |||||
HGSC | 0.391 | ||||
ccRCC | -1.495 | ||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.58 |
BCL2L12-Thr117 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.35 | ||||
COAD | |||||
HGSC | -1.485 | ||||
ccRCC | 0.687 | ||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.449 |
BCL2L13-Ser288 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | 0.707 | ||||
HNSC | |||||
LUAD | -0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Ser291 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | 0.707 | ||||
HNSC | |||||
LUAD | -0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Ser312 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.693 | ||||
COAD | |||||
HGSC | |||||
ccRCC | 0.081 | ||||
GBM | |||||
HNSC | -0.729 | ||||
LUAD | |||||
LUSC | -0.194 | ||||
non_ccRCC | 1.241 | ||||
PDAC | 0.345 | ||||
UCEC | 0.948 |
BCL2L13-Ser315 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.352 | ||||
COAD | |||||
HGSC | 1.857 | ||||
ccRCC | -0.415 | ||||
GBM | |||||
HNSC | -0.336 | ||||
LUAD | |||||
LUSC | -0.57 | ||||
non_ccRCC | 1.042 | ||||
PDAC | -0.121 | ||||
UCEC | -0.106 |
BCL2L13-Ser327 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | 0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | -0.707 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Ser329 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | 0.787 | ||||
ccRCC | -0.543 | ||||
GBM | |||||
HNSC | -1.095 | ||||
LUAD | |||||
LUSC | -0.447 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 1.298 |
BCL2L13-Ser395 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.707 | ||||
HGSC | -0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Ser420 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | 0.707 | ||||
HNSC | |||||
LUAD | -0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Ser426 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | -0.707 | ||||
HNSC | |||||
LUAD | 0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Ser434 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | -0.729 | ||||
GBM | |||||
HNSC | -0.126 | ||||
LUAD | |||||
LUSC | -0.605 | ||||
non_ccRCC | -0.275 | ||||
PDAC | 1.735 | ||||
UCEC |
BCL2L13-Ser444 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -2.092 | ||||
COAD | 0.9 | ||||
HGSC | -0.546 | ||||
ccRCC | -0.271 | ||||
GBM | |||||
HNSC | -0.516 | ||||
LUAD | |||||
LUSC | 0.329 | ||||
non_ccRCC | 0.352 | ||||
PDAC | 1.271 | ||||
UCEC | 0.573 |
BCL2L13-Ser450 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.476 | ||||
COAD | 1.017 | ||||
HGSC | -1.857 | ||||
ccRCC | -0.033 | ||||
GBM | |||||
HNSC | -0.184 | ||||
LUAD | |||||
LUSC | -0.52 | ||||
non_ccRCC | 1.554 | ||||
PDAC | 0.723 | ||||
UCEC | -0.225 |
BCL2L13-Ser453 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.479 | ||||
HGSC | -1.471 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | 0.735 | ||||
PDAC | |||||
UCEC | 0.256 |
BCL2L13-Ser468 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | -0.707 | ||||
HGSC | 0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Thr429 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | -0.707 | ||||
GBM | |||||
HNSC | 0.707 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Thr431 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | -0.707 | ||||
GBM | |||||
HNSC | 0.707 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L14-Ser135 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.901 | ||||
COAD | 0.578 | ||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | -1.232 | ||||
non_ccRCC | |||||
PDAC | 0.522 | ||||
UCEC | 1.032 |
BCL2L14-Ser44 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | 0.973 |
HGSC | |
ccRCC | |
GBM | |
HNSC | -1.491 |
LUAD | |
LUSC | -0.305 |
non_ccRCC | |
PDAC | 0.857 |
UCEC | -0.034 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 70 | A | Cancer | Phosphorylation | 32188705 |
S | 70 | U | Lung cancer/carcinoma | Phosphorylation | 23514933 |
S | 70 | U | Prostate cancer | Phosphorylation | 35013120 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.