Id: | acc1853 |
Group: | 2sens |
Protein: | SKP2 |
Gene Symbol: | SKP2 |
Protein Id: | Q13309 |
Protein Name: | SKP2_HUMAN |
PTM: | acetylation |
Site: | Lys71 |
Site Sequence: | PESPPRKRLKSKGSDKDFVIV |
Disease Category: | Cancer |
Disease: | Prostate Cancer |
Disease Subtype: | |
Disease Cellline: | LNCaP |
Disease Info: | |
Drug: | Dihydrotestosterone |
Drug Info: | "Dihydrotestosterone (DHT) is an endogenous androgen hormone, acting as a potent androgen receptor agonist, and is classified as an androgenic steroid involved in the development and maintenance of male secondary sexual characteristics and accessory glands such as the prostate." |
Relation: |
Dihydrotestosterone
➜
SKP2-Lys71
UP
➜
Prostate Cancer
Alleviate
|
Effect: | modulate |
Effect Info: | "After dihydrotestosterone (DHT) treatment, p300 can bind to and acetylate SKP2 in CRPC, reducing the invasive ability." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 36871351 |
Sentence Index: | 36871351_5-6 |
Sentence: | "We also found that SKP2 acetylation is likely a critical driven event in castration-resistant prostate cancer cells. Mechanistically, SKP2-acetylation is mediated by the p300 acetyltransferase enzyme for post-translational modification (PTM) event that is induced upon stimulation with dihydrotestosterone (DHT) in prostate cancer cells." |
Sequence & Structure:
MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 64 | D | Acute myeloid leukemia | Phosphorylation | 34002296 |
S | 256 | U | Breast cancer | Phosphorylation | 30413706 |
- | - | U | Chronic myeloid leukemia | Ubiquitination | 31044085 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.