Id: acc1852
Group: 2sens
Protein: SKP2
Gene Symbol: SKP2
Protein Id: Q13309
Protein Name: SKP2_HUMAN
PTM: acetylation
Site: Lys68
Site Sequence: LGHPESPPRKRLKSKGSDKDF
Disease Category: Cancer
Disease: Prostate Cancer
Disease Subtype:
Disease Cellline: LNCaP
Disease Info:
Drug: Dihydrotestosterone
Drug Info: "Dihydrotestosterone (DHT) is an endogenous androgen hormone, acting as a potent androgen receptor agonist, and is classified as an androgenic steroid involved in the development and maintenance of male secondary sexual characteristics and accessory glands such as the prostate."
Relation:
Dihydrotestosterone
SKP2-Lys68 UP
Prostate Cancer Alleviate
Effect: modulate
Effect Info: "After dihydrotestosterone (DHT) treatment, p300 can bind to and acetylate SKP2 in castration-resistant prostate cancer (CRPC), reducing the invasive ability."
Note:
Score: 4.0
Pubmed(PMID): 36871351
Sentence Index:
Sentence:

Sequence & Structure:

MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
S 64 D Acute myeloid leukemia Phosphorylation 34002296
S 256 U Breast cancer Phosphorylation 30413706
- - U Chronic myeloid leukemia Ubiquitination 31044085

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: