Id: acc1827
Group: 2sens
Protein: histone H3
Gene Symbol: H3C1
Protein Id: P68431
Protein Name: H31_HUMAN
PTM: methylation
Site: Lys27
Site Sequence: RKQLATKAARKSAPATGGVKK
Disease Category: Cancer
Disease: Leukemia
Disease Subtype:
Disease Cellline: HL-60
Disease Info:
Drug: ATRA
Drug Info: "ATRA (All-trans retinoic acid) is a vitamin A derivative used topically for treating acne vulgaris, psoriasis, and other dermatological conditions, and orally as a primary treatment for acute promyelocytic leukemia (APL) in combination regimens. "
Relation:
ATRA
histone H3-Lys27 DOWN
Leukemia Alleviate
Effect: modulate
Effect Info: "Treatment with ATRA reduces H3 methylation and increases H4 acetylation, and enhances the expression of CD11B."
Note: histone
Score: 3.0
Pubmed(PMID): 19578722
Sentence Index:
Sentence:

Sequence & Structure:

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
K 27 A Oligodendroglioma Methylation 34020723
K 27 D Cervical intraepithelial neoplasia Acetylation 28716899
K 27 D Acute myelogenous leukemia Methylation 22897849
K 27 D Autism spectrum disorder Methylation 23423141
K 27 D Malignant peripheral nerve sheath tumor Methylation 28752843
K 27 D Ovarian cancer Methylation 20053926
K 27 D Systemic lupus erythematosus Methylation 36165173
K 27 U Anaplastic large cell lymphoma Acetylation 22899583
K 27 U Melanoma Acetylation 32079144
K 27 U Merkel cell carcinoma Acetylation 25941994
K 27 U Fragile X syndrome Methylation 18628788
K 27 U Follicular lymphoma Methylation 35661922
K 27 U Pediatric-type follicular lymphoma Methylation 35661922
K 27 U Primary cutaneous follicle center cell lymphoma Methylation 35661922

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: