Id: acc1825
Group: 2sens
Protein: histone H4
Gene Symbol: H4C1
Protein Id: P62805
Protein Name: H4_HUMAN
PTM: acetylation
Site: Lys5
Site Sequence: -----MSGRGKGGKGLGKGGA
Disease Category: Cancer
Disease: Prostate Cancer
Disease Subtype: CRPC
Disease Cellline: 22Rv1
Disease Info:
Drug: Enzalutamide
Drug Info: "Enzalutamide is an oral androgen receptor inhibitor used for the treatment of non-metastatic and metastatic castration-resistant prostate cancer in adults, with a recommended dosage of 160 mg (four 40 mg soft capsules) once daily."
Relation:
histone H4-Lys5 DOWN
Enzalutamide
Prostate Cancer Alleviate
Effect: resist
Effect Info: Knockdown of HAT1 (reducing H4 protein acetylation) can restore the sensitivity of CRPC cells to enzalutamide (ENZ) to the treatment.
Note: histone
Score: 4.5
Pubmed(PMID): 34323404
Sentence Index:
Sentence:

Sequence & Structure:

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
K 5 D Friedreich's ataxia Acetylation 18045775
K 5 D Fragile X syndrome Methylation 18628788
K 5 U Systemic lupus erythematosus Acetylation 25611806
K 5 U Non-small cell lung cancer Methylation 18974389

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: