Id: | acc1825 |
Group: | 2sens |
Protein: | histone H4 |
Gene Symbol: | H4C1 |
Protein Id: | P62805 |
Protein Name: | H4_HUMAN |
PTM: | acetylation |
Site: | Lys5 |
Site Sequence: | -----MSGRGKGGKGLGKGGA |
Disease Category: | Cancer |
Disease: | Prostate Cancer |
Disease Subtype: | CRPC |
Disease Cellline: | 22Rv1 |
Disease Info: | |
Drug: | Enzalutamide |
Drug Info: | "Enzalutamide is an oral androgen receptor inhibitor used for the treatment of non-metastatic and metastatic castration-resistant prostate cancer in adults, with a recommended dosage of 160 mg (four 40 mg soft capsules) once daily." |
Relation: |
histone H4-Lys5
DOWN
+
Enzalutamide
➜
Prostate Cancer
Alleviate
|
Effect: | resist |
Effect Info: | Knockdown of HAT1 (reducing H4 protein acetylation) can restore the sensitivity of CRPC cells to enzalutamide (ENZ) to the treatment. |
Note: | histone |
Score: | 4.5 |
Pubmed(PMID): | 34323404 |
Sentence Index: | 34323404_0-1 |
Sentence: | "Histone acetyltransferase 1 upregulates androgen receptor expression to modulate CRPC cell resistance to enzalutamide. Castration-resistant prostate cancer (CRPC) is the latest stage of PCa, and there is almost no effective treatment available for the patients with CRPC when next-generation androgen deprivation therapy drugs, such as enzalutamide (ENZ), fail." |
Sequence & Structure:
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
K | 5 | D | Friedreich's ataxia | Acetylation | 18045775 |
K | 5 | D | Fragile X syndrome | Methylation | 18628788 |
K | 5 | U | Systemic lupus erythematosus | Acetylation | 25611806 |
K | 5 | U | Non-small cell lung cancer | Methylation | 18974389 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.