Id: | acc1809 |
Group: | 2sens |
Protein: | MtCK1 |
Gene Symbol: | CKMT2 |
Protein Id: | P17540 |
Protein Name: | KCRS_HUMAN |
PTM: | phosphorylation |
Site: | Tyr153 |
Site Sequence: | DLDASKITQGQFDEHYVLSSR |
Disease Category: | Cancer |
Disease: | Breast Cancer |
Disease Subtype: | "Ductal Carcinoma, HER2+" |
Disease Cellline: | BT474(trastuzumab-resistant) |
Disease Info: | |
Drug: | Lapatinib |
Drug Info: | "Lapatinib is a targeted therapy drug used in combination with capecitabine for the treatment of HER2-overexpressing advanced or metastatic breast cancer in patients who have received prior anthracycline, taxane, and trastuzumab-based therapies." |
Relation: |
MtCK1-Tyr153
DOWN
+
Lapatinib
➜
Breast Cancer
Alleviate
|
Effect: | inhibit |
Effect Info: | A decrease in MtCK1 phosphorylation promotes the efficacy of drug treatment. |
Note: | |
Score: | 5.0 |
Pubmed(PMID): | 30174304 |
Sentence Index: | 30174304_2-3 |
Sentence: | "Here, we show that oncogenic HER2 tyrosine kinase signaling induces phosphorylation of mitochondrial creatine kinase 1 (MtCK1) on tyrosine 153 (Y153) in an ABL-dependent manner in breast cancer cells. Y153 phosphorylation, which is commonly upregulated in HER2+ breast cancers, stabilizes MtCK1 to increase the phosphocreatine energy shuttle and promote proliferation." |
Sequence & Structure:
MASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
CKMT2-Ser233 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | 0.56 |
GBM | |
HNSC | -1.155 |
LUAD | |
LUSC | |
non_ccRCC | 0.595 |
PDAC | |
UCEC |
CKMT2-Ser319 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | 0.354 |
GBM | |
HNSC | -1.129 |
LUAD | |
LUSC | |
non_ccRCC | 0.775 |
PDAC | |
UCEC |
CKMT2-Thr316 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | 0.707 |
GBM | |
HNSC | -0.707 |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
CKMT2-Thr356 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | |
GBM | |
HNSC | -0.707 |
LUAD | |
LUSC | |
non_ccRCC | 0.707 |
PDAC | |
UCEC |
CKMT2-Tyr368 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | |
GBM | |
HNSC | -0.707 |
LUAD | |
LUSC | |
non_ccRCC | 0.707 |
PDAC | |
UCEC |
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.