Id: acc1756
Group: 2sens
Protein: Bad
Gene Symbol: BAD
Protein Id: P50408
Protein Name: VATF_RAT
PTM: phosphorylation
Site: Ser99
Site Sequence: EIPSKEHPYDAAKDSILRRAK
Disease Category: Cancer
Disease: Melanoma
Disease Subtype:
Disease Cellline: A2058
Disease Info:
Drug: Sorafenib
Drug Info: "Sorafenib (BAY 43-9006) is an orally active multi-kinase inhibitor targeting Raf-1 (IC50 = 6 nM), B-Raf (IC50 = 20 nM), VEGFR2 (IC50 = 90 nM), VEGFR3 (IC50 = 15 nM), PDGFRbeta (IC50 = 20 nM), FLT3 (IC50 = 57 nM), and c-Kit (IC50 = 58 nM), with demonstrated antitumor activity through induction of apoptosis, autophagy, and ferroptosis."
Relation:
Sorafenib
Bad-Ser99 DOWN
Melanoma Alleviate
Effect: modulate
Effect Info: "BAY 43 - 9006 (sorafenib) induces apoptosis in A2058 and SKMEL5 melanoma cells through a caspase - independent mechanism, which includes the dephosphorylation of Bad and the activation of Bak and Bax."
Note:
Score: 4.0
Pubmed(PMID): 16452220
Sentence Index:
Sentence:

Sequence & Structure:

MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDLR

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC
BAD-Ser99
Cancer Intensity
BRCA 0.402
COAD -1.167
HGSC 1.633
ccRCC -1.772
GBM -0.506
HNSC -0.659
LUAD -0.029
LUSC 0.613
non_ccRCC 0.977
PDAC -0.255
UCEC 0.764

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: