Id: | acc1755 |
Group: | 2sens |
Protein: | Bad |
Gene Symbol: | BAD |
Protein Id: | P50408 |
Protein Name: | VATF_RAT |
PTM: | phosphorylation |
Site: | Ser75 |
Site Sequence: | INQYIAEMVRHALDAHQRSIP |
Disease Category: | Cancer |
Disease: | Melanoma |
Disease Subtype: | |
Disease Cellline: | A2058 |
Disease Info: | |
Drug: | Sorafenib |
Drug Info: | "Sorafenib (BAY 43-9006) is an orally active multi-kinase inhibitor targeting Raf-1 (IC50 = 6 nM), B-Raf (IC50 = 20 nM), VEGFR2 (IC50 = 90 nM), VEGFR3 (IC50 = 15 nM), PDGFRbeta (IC50 = 20 nM), FLT3 (IC50 = 57 nM), and c-Kit (IC50 = 58 nM), with demonstrated antitumor activity through induction of apoptosis, autophagy, and ferroptosis." |
Relation: |
Sorafenib
➜
Bad-Ser75
DOWN
➜
Melanoma
Alleviate
|
Effect: | modulate |
Effect Info: | "BAY 43 - 9006 (sorafenib) induces apoptosis in A2058 and SKMEL5 melanoma cells through a caspase - independent mechanism, which involves the dephosphorylation of Bad and the activation of Bak and Bax." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 16452220 |
Sentence Index: | 16452220_3-4 |
Sentence: | "At concentrations that suppress extracellular signal-regulated kinase (ERK) phosphorylation, BAY 43-9006 dephosphorylates Bad on Ser(75) and Ser(99), activates Bak and Bax, and reduces the mitochondrial transmembrane potential. BAY 43-9006 (sorafenib) down-modulates the levels of Bcl-2 and Bcl-X(L) in a MAPK-independent manner in A2058 and SKMEL5 melanoma cells but not in the more resistant A375 cells." |
Sequence & Structure:
MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDLR
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACBAD-Ser75 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | -0.707 |
HGSC | 0.707 |
ccRCC | |
GBM | |
HNSC | |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.