Id: | acc1734 |
Group: | 2sens |
Protein: | ERK2 |
Gene Symbol: | MAPK1 |
Protein Id: | P28482 |
Protein Name: | MK01_HUMAN |
PTM: | phosphorylation |
Site: | Thr185 |
Site Sequence: | PDHDHTGFLTEYVATRWYRAP |
Disease Category: | Cancer |
Disease: | Osteosarcoma |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Quercetin |
Drug Info: | "Quercetin (QUE) is a naturally occurring flavonoid with antioxidant, anti-inflammatory, and potential anticancer properties, commonly found in various fruits, vegetables, and grains, and used as a dietary supplement for its purported health benefits." |
Relation: |
Quercetin
➜
ERK2-Thr185
UP
➜
Osteosarcoma
Alleviate
|
Effect: | modulate |
Effect Info: | "100 μM quercetin reduced the phosphorylation levels of AKT and BAD and increased the phosphorylation of ERK1/2, leading to the death of osteosarcoma cells." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 35447220 |
Sentence Index: | 35447220_10-11 |
Sentence: | "In addition, the ERK1/2 phosphorylation increased leading to osteosarcoma cell death since pre-treatment with the MEK inhibitor PD98059 had reverted QUE effect. Altogether, these results indicate that low concentrations of QUE stimulate osteoblastogenesis but have no effect on the growth of tumor osteoblast cells, for which only high concentrations are efficient." |
Sequence & Structure:
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Terminated | neoplasm | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 2 | Completed | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Recruiting | histiocytic neoplasm | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Active, not recruiting | Uveal Melanoma | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 2 | Terminated | cancer | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | acute myeloid leukemia | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | myelodysplastic syndrome | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 1 | Recruiting | acute myeloid leukemia | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials |
MAPK1 | RAVOXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Terminated | neoplasm | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Recruiting | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Terminated | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Recruiting | metastatic colorectal cancer | ClinicalTrials |
MAPK1 | KO-947 | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 1 | Terminated | cancer | ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Completed | colorectal cancer | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 0.5 | Recruiting | glioblastoma multiforme | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 0.5 | Recruiting | Paraganglioma | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACMAPK1-Thr185 | |
---|---|
Cancer | Intensity |
BRCA | 2.529 |
COAD | -0.118 |
HGSC | -0.164 |
ccRCC | -0.105 |
GBM | -0.046 |
HNSC | -0.09 |
LUAD | |
LUSC | |
non_ccRCC | -0.821 |
PDAC | -0.882 |
UCEC | -0.302 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | A | Colon cancer/carcinoma | Phosphorylation | 23786838 |
- | - | D | Colorectal cancer | Phosphorylation | 36526622 |
- | - | D | Squamous cell carcinoma of the larynx | Phosphorylation | 16865246 |
- | - | D | Pulmonary carcinoid | Phosphorylation | 15956248 |
- | - | D | Myelodysplasia | Phosphorylation | 12529294 |
- | - | P | Bladder cancer | Phosphorylation | 24375195 |
- | - | P | Non-small cell lung cancer/carcinoma | Phosphorylation | 24096476 |
- | - | P | Acute myeloid leukemia/acute myelogenous leukemia | Phosphorylation | 23840454 |
- | - | P | Liver cancer | Phosphorylation | 23693078 |
- | - | P | Colon cancer/carcinoma | Phosphorylation | 23183114 |
- | - | P | Thyroid cancer/carcinoma | Phosphorylation | 11299771 |
- | - | P | Astrocytoma/astrocytoma glioblastoma | Phosphorylation | 17327470 |
- | - | P | Rhabdomyosarcoma | Phosphorylation | 14633723 |
- | - | P | Brain cancer | Phosphorylation | 12388552 |
- | - | U | Lung cancer/carcinoma | Phosphorylation | 24286320 |
- | - | U | Bipolar disorder | Phosphorylation | 24075327 |
- | - | U | Glioblastoma | Phosphorylation | 36493392 |
- | - | U | Crohn's disease | Phosphorylation | 23970928 |
- | - | U | Neuroblastoma | Phosphorylation | 15972965 |
- | - | U | Adenoma | Phosphorylation | 21989899 |
- | - | U | Breast cancer/tumor/carcinoma | Phosphorylation | 10216485 |
- | - | U | Prostate cancer/carcinoma/adenocarcinoma | Phosphorylation | 9927031 |
- | - | U | Glioblastoma | Phosphorylation | 23115159 |
- | - | U | Pancreatic cancer | Phosphorylation | 21678462 |
- | - | U | Clear cell renal cell carcinoma | Phosphorylation | 36966163 |
- | - | U | Lymphoma | Phosphorylation | 23620775 |
S | 41 | U | Choriocarcinoma | Phosphorylation | 11466319 |
- | - | U | Clear cell renal cell carcinoma | Phosphorylation | 37454877 |
- | - | U | Osteosarcoma | Phosphorylation | 31383289 |
- | - | U | Ovarian cancer/carcinoma | Phosphorylation | 23285101 |
Y | 204 | U | Pulmonary emphysema | Phosphorylation | 14764579 |
Y | 187 | U | Triple-negative breast cancer | Phosphorylation | 28415597 |
Y | 187 | U | Thyroid cancer/carcinoma | Phosphorylation | 17209045 |
Y | 204 | U | Hepatocellular carcinoma | Phosphorylation | 36230524 |
T | 202 | U | Pulmonary emphysema | Phosphorylation | 14764579 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMProtein | Gene | PTM | Position | Modified sequence | Cell | Drug | pEC50 | Regulation | Experiment |
---|---|---|---|---|---|---|---|---|---|
P28482 | MAPK1 | P | Thr185 | VADPDHDHTGFLT(ph)EYVATR | BT-474 | Lapatinib | 6.6659 | down | |
P28482 | MAPK1 | P | Thr185 | VADPDHDHTGFLT(ph)EYVATR | KYSE-520 | SHP099 | 6.0769 | down | |
P28482 | MAPK1 | P | Thr185 | VADPDHDHTGFLT(ph)EYVATR | MDA-MB-175 | Lapatinib | 7.3575 | down | |
P28482 | MAPK1 | P | Thr185 | VADPDHDHTGFLT(ph)EYVATR | K562 | Imatinib | 7.1978 | - | |
P28482 | MAPK1 | P | Thr185 | VADPDHDHTGFLT(ph)EYVATR | MDA-MB-175 | Trastuzumab | 5 | - | |
P28482 | MAPK1 | P | Thr185;Tyr187 | VADPDHDHTGFLT(ph)EY(ph)VATR | MDA-MB-175 | Trastuzumab | -1.6811 | - | |
P28482 | MAPK1 | P | Thr185;Tyr187 | VADPDHDHTGFLT(ph)EY(ph)VATR | PC-9 | AZD4547 | 7.2923 | - | |
P28482 | MAPK1 | P | Thr185 | VADPDHDHTGFLT(ph)EYVATR | SK-BR-3 | Lapatinib | 4.7264 | - | |
P28482 | MAPK1 | P | Thr185 | VADPDHDHTGFLT(ph)EYVATR | SK-BR-3 | Pertuzumab | -1.769 | - | |
P28482 | MAPK1 | P | Thr185 | VADPDHDHTGFLT(ph)EYVATR | SK-BR-3 | Trastuzumab | -0.9986 | - | |
P28482 | MAPK1 | P | Thr185;Tyr187 | VADPDHDHTGFLT(ph)EY(ph)VATR | SK-BR-3 | Trastuzumab | -1.2287 | - |
pEC50 Note: pEC50 is the negative logarithm of EC50 (half-maximal effective concentration, dosage unit Mol), calculated as pEC50 = -log10(EC50), which quantifies the potency of a drug or compound.
Function score:
source: funscoRNo data.